KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103744053Help
Entry
103744053         CDS       T03372                                 

Gene name
Gsto1
Definition
(RefSeq) glutathione S-transferase omega 1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi00480  Glutathione metabolism
ngi00980  Metabolism of xenobiotics by cytochrome P450
ngi00982  Drug metabolism - cytochrome P450
ngi00983  Drug metabolism - other enzymes
ngi01524  Platinum drug resistance
ngi05200  Pathways in cancer
ngi05204  Chemical carcinogenesis
ngi05225  Hepatocellular carcinoma
ngi05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    103744053 (Gsto1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    103744053 (Gsto1)
   00982 Drug metabolism - cytochrome P450
    103744053 (Gsto1)
   00983 Drug metabolism - other enzymes
    103744053 (Gsto1)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    103744053 (Gsto1)
   05204 Chemical carcinogenesis
    103744053 (Gsto1)
  09162 Cancers: Specific types
   05225 Hepatocellular carcinoma
    103744053 (Gsto1)
  09166 Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    103744053 (Gsto1)
  09176 Drug resistance: Antineoplastic
   01524 Platinum drug resistance
    103744053 (Gsto1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ngi02000]
    103744053 (Gsto1)
Enzymes [BR:ngi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     103744053 (Gsto1)
Transporters [BR:ngi02000]
 Other Transporters
  Pores ion channels [TC:1]
   103744053 (Gsto1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_3 GST_C_2 GST_C GST_C_5 Glutaredoxin Glutaredoxin2_C
Motif
Other DBs
NCBI-GeneID: 103744053
NCBI-ProteinID: XP_008843928
LinkDB All DBs
Position
Un
AA seq 242 aa AA seqDB search
MSGVSETRSLGRGSASPGPVPEGQIRVYSMRFCPFALRTLLVLKAKGIRHEVININLKNK
PEWFFEKNPLGLVPVLENSQGHLVCESVITCEYLDEVYPEKKLLPSDPYEKACQKMIFEL
FSKVPTLMARLFGVQNKEERSGIKEELQKEFSKLEEVLTKKKTTFFGGNTLSMIDYLMWP
WFQRLELLELTEYITHTPKLKLWVAAMQKDPAVSALLLDAKAFHGFVGLYLQDSPEACDY
GL
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgtccggggtgtctgaaaccaggagcctggggaggggaagcgcgtccccgggcccggtc
ccggagggccagatccgcgtctacagtatgaggttctgcccgtttgctctgaggacgctg
ctggtcctgaaggccaagggaatccgtcacgaagtcatcaacatcaacctgaaaaataag
cctgagtggttctttgagaagaatccacttgggctggtaccagtcctggagaatagtcag
ggccacttggtctgtgaatctgtcatcacttgtgaatatctggatgaagtctatccggag
aagaagttgctgccgagtgacccttacgagaaagcttgtcaaaagatgatctttgagcta
ttttctaaggtgccaactttgatggcaagactctttggagtgcaaaataaagaagaacgt
tctggcataaaagaggaactgcagaaagaattcagcaagctagaggaggttctgactaag
aagaagaccaccttttttggtgggaacactctctctatgattgattacctcatgtggccc
tggtttcaacggctagaattactggagctaactgagtacataacccatactcccaaactc
aagctctgggtggcagcaatgcagaaggatcccgcagtatcggccctcctgcttgatgcc
aaggcctttcatggtttcgtgggtctctacctacaagatagtcctgaggcctgcgactat
gggctttga

DBGET integrated database retrieval system