KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103744567
Entry
103744567         CDS       T03372                                 

Gene name
Lep
Definition
(RefSeq) leptin
  KO
K05424  leptin
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04080  Neuroactive ligand-receptor interaction
ngi04152  AMPK signaling pathway
ngi04630  JAK-STAT signaling pathway
ngi04920  Adipocytokine signaling pathway
ngi04932  Non-alcoholic fatty liver disease
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103744567 (Lep)
   04152 AMPK signaling pathway
    103744567 (Lep)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103744567 (Lep)
   04060 Cytokine-cytokine receptor interaction
    103744567 (Lep)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103744567 (Lep)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    103744567 (Lep)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103744567 (Lep)
Cytokines and growth factors [BR:ngi04052]
 Cytokines
  CSF and other factors
   103744567 (Lep)
SSDB
Motif
Pfam: Leptin
Other DBs
NCBI-GeneID: 103744567
NCBI-ProteinID: XP_008844614
LinkDB
Position
Un
AA seq 167 aa
MYWRPLCQFLWLWSYLFHVQAVPIQKVQDDTKTLIKTIVTRINDISHTQSVSAKQRVTGL
DFIPGLHPILSLSKMDQTLAIYQQILTSLPSRNVMQISNDLENLRDLLHLLASSKSCPLP
QTRGPQKPESLDGVLEASLYSTEVVALSRLQGSLQDMLRQLDLSPSC
NT seq 504 nt   +upstreamnt  +downstreamnt
atgtactggagacccctgtgccagttcctgtggctttggtcctatctgttccatgttcaa
gctgtacctatccagaaagtccaggatgacaccaaaaccctcatcaagaccattgtcacc
aggattaacgacatttcacacacacagtcagtgtctgccaagcagagagttactggtttg
gacttcattcctgggctccaccccatcctgagtctgtccaagatggaccagacactggca
atctaccaacagatcctcaccagtctgccttcccgaaatgtgatgcaaatatctaacgac
ctagagaacctccgggaccttctccacctgctggcctcctccaagagctgccccctgccc
cagaccagaggcccacagaagccagagagcttggatggcgttctggaagcctctctctat
tccacagaggtggtggccctgagtaggctgcagggctctctgcaggacatgctgcgacag
ctggacctcagccccagctgctga

DBGET integrated database retrieval system