KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103744639
Entry
103744639         CDS       T03372                                 

Gene name
Tgfbr2
Definition
(RefSeq) transforming growth factor beta receptor 2
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04010  MAPK signaling pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04068  FoxO signaling pathway
ngi04144  Endocytosis
ngi04218  Cellular senescence
ngi04350  TGF-beta signaling pathway
ngi04380  Osteoclast differentiation
ngi04390  Hippo signaling pathway
ngi04520  Adherens junction
ngi04659  Th17 cell differentiation
ngi04926  Relaxin signaling pathway
ngi04933  AGE-RAGE signaling pathway in diabetic complications
ngi05142  Chagas disease
ngi05161  Hepatitis B
ngi05166  Human T-cell leukemia virus 1 infection
ngi05200  Pathways in cancer
ngi05202  Transcriptional misregulation in cancer
ngi05210  Colorectal cancer
ngi05212  Pancreatic cancer
ngi05220  Chronic myeloid leukemia
ngi05225  Hepatocellular carcinoma
ngi05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103744639 (Tgfbr2)
   04350 TGF-beta signaling pathway
    103744639 (Tgfbr2)
   04390 Hippo signaling pathway
    103744639 (Tgfbr2)
   04068 FoxO signaling pathway
    103744639 (Tgfbr2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103744639 (Tgfbr2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103744639 (Tgfbr2)
  09143 Cell growth and death
   04218 Cellular senescence
    103744639 (Tgfbr2)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    103744639 (Tgfbr2)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    103744639 (Tgfbr2)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    103744639 (Tgfbr2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103744639 (Tgfbr2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103744639 (Tgfbr2)
   05202 Transcriptional misregulation in cancer
    103744639 (Tgfbr2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103744639 (Tgfbr2)
   05212 Pancreatic cancer
    103744639 (Tgfbr2)
   05225 Hepatocellular carcinoma
    103744639 (Tgfbr2)
   05226 Gastric cancer
    103744639 (Tgfbr2)
   05220 Chronic myeloid leukemia
    103744639 (Tgfbr2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    103744639 (Tgfbr2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103744639 (Tgfbr2)
   05161 Hepatitis B
    103744639 (Tgfbr2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    103744639 (Tgfbr2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ngi01001]
    103744639 (Tgfbr2)
Enzymes [BR:ngi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     103744639 (Tgfbr2)
Protein kinases [BR:ngi01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   103744639 (Tgfbr2)
SSDB
Motif
Pfam: ecTbetaR2 PK_Tyr_Ser-Thr Pkinase Pkinase_fungal APH
Other DBs
NCBI-GeneID: 103744639
NCBI-ProteinID: XP_008844691
LinkDB
Position
Un
AA seq 567 aa
MGRGLLRGLWPLHIVLWTRIASTIPPQVPKSVNDDMIASDNSGAVKISQLCKFCDVRSST
CDNQKTCMSNCSITSICEKPYEVCVAVWRKNDENITLETVCHDPKLKYHGFILEDATSPK
CIMKEKKVLGETFFMCSCNTEECNDYIIFSEEYTASSPDLLLVIIQVTGVSLLPPLGIAI
AVIIIFYCYRVHRQQKLSPSWESSKPRKLMEFSEHCAIILEDDRSDISSTCANNINHNTE
LLPIELDTLVGKGRFAEVYKAKLKQNTSEQFETVAVKIFPYEEYASWKTEKDIFSDINLK
HENILQFLTAEERKTELGKQYWLITAFHAKGNLQEYLTRHVISWEDLRKLGSSLARGIAH
LHSDHTPCGRPKMPIVHRDLKSSNILVKNDLTCCLCDFGLSLRLDPTLSVDDLANSGQVG
TARYMAPEVLESRMNLENVESFKQTDVYSMALVLWEMTSRCNAVGEVKDYEPPFGSKVRE
HPCVESMKDNVLRDRGRPEIPSFWLNHQGIQNVCETLTECWDHDPEARLTAQCVAERFSE
LEHLDRLSGRTCSEEKIPEDGSLNTTK
NT seq 1704 nt   +upstreamnt  +downstreamnt
atgggtcgggggctgctccggggcctgtggccgctgcacatcgtcctgtggacgcgcatc
gccagcacgatcccaccgcaagttcccaagtcggttaacgatgacatgatagccagtgac
aacagtggtgccgtcaagatttcacaactatgcaagttttgtgatgtgagatcttccacc
tgtgacaaccagaaaacctgcatgagcaactgcagcatcacatccatctgtgagaagccg
tatgaagtctgcgtggccgtgtggaggaagaatgatgaaaatataacactagaaacagtg
tgccatgaccccaagctcaagtaccacggatttattctagaagacgcaacttcaccaaag
tgcatcatgaaagaaaagaaagttctgggcgagactttcttcatgtgctcctgtaacacg
gaggagtgcaatgactacatcatcttctcagaagaatatactgccagcagtcctgacctg
ttgttagtcataattcaagtgacgggtgttagcctcctgcctccactgggcattgccata
gctgtcatcatcatcttctactgttatcgtgtccaccggcagcagaagctgagcccatcc
tgggaaagcagcaagccccgaaagctcatggagttcagtgagcactgtgccatcatcctg
gaagatgaccgctctgatatcagctccacgtgcgccaacaacatcaaccacaacacggaa
ctcctgcccattgagctggacacgctggtggggaagggccgtttcgccgaggtctacaag
gccaagctaaaacagaacacgtcagagcagtttgagaccgtggccgtcaagatcttcccc
tacgaggagtatgcttcctggaaaacagagaaagacatcttctcagatatcaacctgaaa
catgagaacatcctccagttccttaccgccgaggagcggaagacagagttgggaaagcag
tactggctgatcaccgcattccatgccaagggcaacctccaggagtatctcaccaggcat
gtcatcagctgggaggacctgcggaagctgggtagctccctggctcggggcattgctcac
ctccacagtgatcacaccccgtgtgggaggcccaagatgcccattgttcacagggacctc
aagagctccaacatcctcgtgaagaatgacctgacctgttgcctgtgtgactttggactg
tccctgcgcctggaccctaccctgtctgtggatgatctggccaacagtggacaggtggga
actgcaagatacatggcacctgaagttctagaatccaggatgaatttggagaacgtcgag
tcctttaagcagacagatgtctactccatggctctagtgctctgggaaatgacatctcgc
tgcaatgcggtgggagaagtgaaagattacgagcctccatttggttccaaggtgagggag
cacccctgcgtggaaagcatgaaggacaacgtactaagagatcgaggacgacccgaaatt
ccaagcttctggctcaaccaccagggcatccagaacgtatgcgagacactgaccgagtgc
tgggaccatgacccagaggcccgcctcacagcccagtgtgtggcagagcgcttcagtgag
ctagagcacctggacaggctttctgggaggacctgctctgaagagaagattccagaagat
ggctcgctgaacactaccaaatag

DBGET integrated database retrieval system