KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103744762Help
Entry
103744762         CDS       T03372                                 

Definition
(RefSeq) angiotensin-converting enzyme
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04614  Renin-angiotensin system
ngi04924  Renin secretion
ngi05142  Chagas disease (American trypanosomiasis)
ngi05410  Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    103744762
   04614 Renin-angiotensin system
    103744762
 09160 Human Diseases
  09165 Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    103744762
  09167 Infectious diseases
   05142 Chagas disease (American trypanosomiasis)
    103744762
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ngi01002]
    103744762
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ngi04147]
    103744762
   04090 CD Molecules [BR:ngi04090]
    103744762
Enzymes [BR:ngi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     103744762
Peptidases [BR:ngi01002]
 Metallo Peptidases
  Family M2
   103744762
Exosome [BR:ngi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103744762
CD molecules [BR:ngi04090]
 Proteins
  103744762
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-GeneID: 103744762
NCBI-ProteinID: XP_008844827
LinkDB All DBs
Position
Un
AA seq 1305 aa AA seqDB search
MGAASGRRGRPQSPLSPLLLPLLPFTLALAPGLQPGNFSADEAGAQLFADSYNSSAEQVL
FQSTAASWAHDTNITEENARRQEEAALLSQEFAEVWGQKAKELYEAIWQNFTDSKLRRII
GAVRTLGPANLPLTKRQQYNALLSNMSRIYSTSKVCFPNKTATCWSLDPELTNILASSRS
YAKLLFAWEGWHDAVGIPLKPLYQDFTALSNEAYRQDGFLDTGDYWRSWYDSPTFEENLE
HLYHQLEPLYLNLHAYVRRALHRRYGDKYINLRGPIPAHLLGDMWAQSWDNIYDMVVPFP
DKPNLDVTSTMVQKGWNATHMFRVAEEFFTSLGLSPMPPEFWAESMLEKPTDGREVVCHA
SAWDFYNRKDFRIKQCTRVTMDQLSTVHHEMGHVQYYLQYKDLPVSLRRGANPGFHEAIG
DVLALSVSTPAHLHKIGLLDHVANDMKSDINYLLKMALEKIAFLPFGYLVDQWRWGVFNG
HTPPSHYNFDWWYLRTKYQGICPPVVRKETHFDAGAKFHIPNVMPYIRYFVSFVLQFQFH
QALCKEAGHQGPLHQCDIYQSVQAGAKLRKVLQAGCSRPWQEVLKDMVGSDALDAQALLN
YFHPVSQWLQEQNQQNGEVLGWPEYQWRPPLPDKYPEGIDLVTDEAEANKFVEEYDRTAQ
VVWNDFAEANWNYNTNITIAASKILLQKNKKVANHTLKYGIWAKQFDVSNFQNSTTKRII
KKVQNLDRAALTPSDLEEYNKILLDMETTYSIANVCYDNGTCLQLEPDLTNLMATSRKYE
ELLWVWKKWRDSAGKTILPLFPKYVELTNKVARLNGFADGGDSWRSLYETDNLEQILEQL
YEELQPLYLNLHAYVRRALHHHYGPQYISLDGPIPAHLLGNMWAQTWSNIYDLVAPFPSA
PNLDATEAMIKQGWTPRRIFKEADDFFTSLGLLPVPSEFWNKSMLEKPTDGREVVCHASA
WDFYNGKDFRIKQCTSVNMEELVIAHHEMGHIQYFMQYKDLPVSFREGANPGFHEAIGDV
LALSVSTPKHLHSINLLSSEGSGYEHDINFLMKMALDKIAFIPFSYLIDQWRWRVFNGSI
TKANYNQEWWSLRLKYQGLCPPVLRSQSDFDPGSKFHVPASVPYIRYFISFIIQFQFHEA
LCRAAGHTGPLHKCDIYQSKEAGKLLADTMKLGYSKPWPEAMKLITGQPNMSASAMMNYF
KPLMDWLITENKRHRETLGWPQYNWTPNTARSEGPFSDSGHVNFLGMNLEPQQARVGQWV
LLFLGIALLVATLGLTQRLFSIRKYNIRWPHRGPQFGSEVELRHS
NT seq 3918 nt NT seq  +upstreamnt  +downstreamnt
atgggggccgcgtcaggccggcgggggcggccccagtcgccactgtcgccgctgctgctg
ccgctgctgccgttcaccctggcgctcgcccctggattgcagcccggcaacttttccgcg
gatgaggccggggcgcagctcttcgccgacagctacaactccagcgccgagcaggtgctg
ttccagagcacggcagccagctgggcgcacgacaccaacatcaccgaggagaatgctcgg
cgccaggaggaagcagccctgctcagccaggagtttgcagaggtctggggccagaaggcc
aaggagctgtacgaggccatctggcagaacttcactgactcaaagctgcgaaggatcatt
ggagctgtacgcaccctcggacctgccaacctgcccctgaccaaaaggcagcagtacaat
gctctgctaagcaacatgagcaggatctactccacaagcaaggtctgcttccccaacaag
actgccacctgctggtcgctcgacccagagctcaccaacatcctggcttcctcacgaagc
tatgccaagctgctgtttgcctgggagggctggcatgatgctgtgggcatcccactgaaa
cccctgtaccaggactttactgctctcagcaatgaggcctacagacaggatggcttcttg
gacacaggagattactggcgctcctggtatgattcccccacctttgaagagaacctggag
cacctctaccaccaattagagcctctctacctgaacctccatgcctacgtccgccgtgca
ctgcatcgacgctatggagacaaatacatcaacctgagggggcccatccctgctcatctg
ctaggagacatgtgggcccagagctgggacaatatctatgacatggtggtgcctttccca
gacaagcccaacctcgatgtcacaagtacaatggtgcagaagggctggaatgccacacac
atgttccgggttgcagaggaattcttcacctctctggggctctctcccatgcctcctgag
ttctgggcagagtccatgctggagaagccaactgacgggcgggaggtggtgtgccacgcc
tcagcctgggacttctacaacaggaaggacttcaggatcaagcaatgcacacgagtcaca
atggaccagctgtccacagtgcaccatgagatgggccacgtgcagtactacctacagtac
aaggacctgcctgtctccctgcgtagaggcgccaaccccggtttccatgaggccatcggg
gatgtgctggcactctctgtctccactcctgcacatctgcacaaaataggcctgctggac
catgttgccaatgacatgaaaagtgatattaattacttgctaaagatggccctggagaaa
attgctttcctgccgtttggctacctggtagatcagtggcgctggggggtcttcaatgga
cataccccaccatcccactacaactttgactggtggtatcttcgaaccaagtatcaggga
atttgccctccagttgtccggaaagaaactcactttgatgctggagctaagtttcatatc
ccaaatgtgatgccatatatcaggtactttgtgagttttgttctgcagttccagtttcat
caagccctgtgcaaggaggcaggccaccagggcccactgcaccagtgtgacatctaccag
tctgtccaggcgggggccaagctccggaaggtgctgcaggctggctgctccaggccgtgg
caggaggtgctgaaggacatggtgggctcagatgccctagatgcccaggcactgctgaac
tacttccatccggtcagccagtggctacaggagcagaaccaacagaatggcgaggtcctg
ggctggccagagtaccagtggcgaccaccattacctgacaagtacccagaaggcattgat
ctagtgactgatgaagctgaggctaacaagtttgtggaggagtatgaccggacagcccag
gtggtgtggaacgactttgcagaggccaactggaactacaacaccaacatcaccatagca
gccagcaagatcctgcttcagaaaaataagaaagtagccaatcacaccctgaaatatggc
atctgggccaagcagtttgatgtgagcaacttccagaactccaccaccaagcggatcata
aagaaggttcagaacctggatagagcagcactgacaccctcagatttagaggagtacaac
aagatcctgctggacatggagaccacttacagcatagccaatgtatgctacgacaatggc
acctgcttacagctggagcctgatctgacaaatttgatggccacatcccggaaatatgaa
gagctgctttgggtgtggaagaaatggcgagacagtgcaggaaaaactatcctccccctt
ttccccaagtatgtggaacttaccaacaaggtcgcccggctcaacggctttgctgatggt
ggagactcatggcgatccctgtacgagactgacaacctggaacaaatcctggaacagctc
tatgaggagctgcagccactgtacctgaacctgcatgcctatgtgcgccgtgccctgcac
caccactatgggccccagtacatcagcctggatggtcccattcctgcccacctactaggg
aacatgtgggctcagacctggtccaacatctatgacttggtggcgcccttcccttcagcc
cccaacttggatgctacagaggccatgataaagcagggatggacacccagaaggatattt
aaggaagctgacgatttcttcacctctctggggctgctacctgtgccctctgagttctgg
aacaagtcaatgctggagaagccaactgacggaagggaggtggtatgccatgcctcggcc
tgggacttctacaatggcaaagacttcaggatcaagcagtgcacctctgtgaacatggag
gagctggtgatagcccatcatgaaatggggcatatccagtatttcatgcagtacaaagac
ttgcctgtgtcctttcgggagggtgccaaccctggctttcatgaggctattggggatgtg
ctggctctctcagtgtctacccccaagcacctacacagcatcaacctgctgagtagcgag
ggcagtggctatgagcatgacatcaactttctgatgaagatggccctggacaagatcgcc
ttcatccccttcagctacctcattgaccagtggcgctggagggtctttaatggaagcatc
accaaggcaaactacaaccaggagtggtggagtctcaggctgaagtaccagggtctctgc
cctccagtactcagatctcaaagtgactttgacccagggtccaagttccatgttcctgca
agtgtgccttatatcaggtactttataagcttcatcatccagttccagttccacgaggca
ctgtgccgggcagctgggcacacaggccccctgcacaaatgtgacatctaccaatccaag
gaggcaggaaagctcctggcggataccatgaagctgggctacagtaagccatggccagaa
gccatgaagctgatcacaggccagcctaacatgtcagcctcagccatgatgaactacttc
aagccactgatggactggctcatcactgagaacaagaggcacagggagacactgggctgg
cctcagtataactggacaccaaacactgctcgctcggaaggccccttctcagactctggc
cacgtcaacttcctgggcatgaacctggagccacagcaggcccgtgtgggccagtgggtg
ctactcttccttggcattgccctgctggtggctaccttgggtctcacccagaggctcttc
agcattcgcaagtacaacatccgctggccccaccgtgggccccagtttggctctgaagtg
gagctcagacactcctga

DBGET integrated database retrieval system