KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103744814Help
Entry
103744814         CDS       T03372                                 

Gene name
Kmt5c
Definition
(RefSeq) lysine methyltransferase 5C
  KO
K11429  histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    103744814 (Kmt5c)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ngi03036]
    103744814 (Kmt5c)
Enzymes [BR:ngi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     103744814 (Kmt5c)
Chromosome and associated proteins [BR:ngi03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     103744814 (Kmt5c)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET FAM75
Motif
Other DBs
NCBI-GeneID: 103744814
NCBI-ProteinID: XP_008844884
LinkDB All DBs
Position
Un
AA seq 467 aa AA seqDB search
MGPERVTARELCENDDLATSLVLDPYLGFRTHKMNVSPVPPLRRQHHLRSALEAFLRQRD
LEAAYRALTLGGWMTHYFQNRDPRQEAALKTHIFRYLRAFLPESGFAILPCTRYSMETNG
AKIVSTRAWKKNEKVELLVGCIAELREADEGLLRAGENDFSIMYSTRKRSAQLWLGPAAF
INHDCKPNCKFVPSDGNNACVKVLRDIEPGDEVTCFYGEGFFGEKNEHCECYTCERKGEG
AFRLQPRQLELLPQPSDKYELRETKRRLQRVGDSCQQNLLGLRACSHLSPLRRDPFCAAC
QPLRLPPASPHLDYLPLWLQWLPVPQPQPRVRPRKRRRPRLHRPSAAPVLRAASVSLHQW
GGCGSHCCLQAEAVVALGLLPKTRWTPQQDWHWARRYGLPYVVRVDLKRLAPALPAAPAP
AGTPGPVPTPVPIPKQALAFAPFSPHKRLRLVVSHGSIDLDINSDEP
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atggggcctgaaagagtgacagcccgagaactgtgcgaaaatgatgacctggctaccagc
cttgtccttgacccctacctcggcttccgcacccataagatgaacgtcagccctgtgccc
cccctgcgacgacaacaccaccttcgctcagcactggaagccttcttaaggcaacgggac
ctggaggctgcataccgggccctgacgctgggaggctggatgacccactatttccagaac
cgggaccctcggcaggaggctgccctcaagacccacatttttcgctacctccgagccttc
ctgcccgaaagtggtttcgctatcctgccctgcacccgctattccatggagaccaatggg
gccaagatcgtgtctactcgtgcttggaagaagaacgagaaggtggagctgctggtgggc
tgcatcgccgagcttcgcgaggcggatgaggggctgctcagggccggggagaacgatttc
agcatcatgtactccacccgcaaaaggagtgcccagctgtggcttggcccagctgctttc
atcaaccatgactgcaaacccaactgtaagtttgtaccctcagatggaaacaacgcctgc
gtaaaggtgctccgggacattgagccaggggatgaggtgacgtgcttctatggcgagggc
ttcttcggtgagaagaatgagcactgtgaatgctacacctgcgagaggaaaggcgaagga
gccttccgacttcagcccaggcagctggagctgctgccacagccctcggacaagtatgag
ctccgggagacaaagcggcgactacagcgtgttggggacagctgccagcagaacctgctg
ggcctgagagcctgttctcacctgtccccactgcgccgagaccccttctgtgccgcctgc
cagcccctacgcctgccccctgccagcccccacctggactacttgcccctctggctccag
tggctgcctgtgcctcagccccagcccagagtacgcccccggaagcgccgacgcccacgg
ctccacaggccttcagcagcccccgtcctccgtgctgcctctgtctccctacaccaatgg
ggaggctgtggttcccactgctgcctacaggctgaggctgtggtggccctgggcctgctc
cccaaaacccgctggactccacaacaagactggcactgggcccggcgctatgggctgcct
tacgtggtgcgtgtggaccttaaacgcctggccccagccctaccagctgcccctgctcct
gctgggaccccaggccctgtccccacccctgtccccattcctaagcaggcccttgccttc
gcccctttctccccacataagcgcctgcggctggtggtcagtcatggctctattgacttg
gacatcaacagtgatgagccatga

DBGET integrated database retrieval system