KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103744950Help
Entry
103744950         CDS       T03372                                 

Gene name
Ganc
Definition
(RefSeq) glucosidase alpha, neutral C
  KO
K12317  neutral alpha-glucosidase C [EC:3.2.1.20]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi00052  Galactose metabolism
ngi00500  Starch and sucrose metabolism
ngi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    103744950 (Ganc)
   00500 Starch and sucrose metabolism
    103744950 (Ganc)
Enzymes [BR:ngi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     103744950 (Ganc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 103744950
NCBI-ProteinID: XP_008845039
LinkDB All DBs
Position
Un
AA seq 914 aa AA seqDB search
MEAAEKQEISVEDEAVDKTIFRDCNKIAFYRRQKQQLSKNTTYQALLESVTTGQESTKFQ
IINKATKIPLLAEIYGIERNIFRLKINEEAPLKPRYEVPDVITSKLGAVRLVSCSGDAGS
LILANGKGDLKCHITANPFKIDLEFKKETVLSINSLGQLYFEHLQIPQKQRATKGNEEST
AADTSQENQEDLGLWEEKFGKFVDVKANGPSSVGLDFSLYGFEHLYGIPQHAESHQLKNT
RDGDAYRLYNLDVYGYQIHDKMGIYGSVPYLLAHKQGRTIGIFWLNASETLVEINTEPAV
EYTLTQVGPAAAKQKVGCRTDVRWMSESGIIDVFLLLGPTPSDIFKQYSYLTGTQAMPPL
FSLGYHQCRWNYEDEQDVKAVDAGFDEHDIPYDVMWLDIEHTEGKKYFTWDKKRFANPKR
MQELLRSKKRKLVVISDPHIKVDPDYSVYAKAKEEGFFVRTPQGGDFEGVCWPGLSSYLD
FTSPKVREWYSSLFDFPVYQGSTDILFVWNDMNEPSVFRGPELTMQKNAIHYGNWEHREL
HNIYGFYQQMATAEGLIKRSQGKERPFVLSRSFFAGSQKYGAVWTGDNTAEWSYLKVSIP
MLLTLSISGISFCGADVGGFIGNPEPELLVRWYQAGAYQPFFRGHATMNTKRREPWLFGE
EHTRLIREAIKERYTLLPYLYSLFYHAHMSSEPVMRPLWIEFPDELETFGVEDEYMLGSA
LLVHPVTELQAAMVDVFLPGPNEIWYDSKTFAHWKGGCTVKIPVALDTIPVFQRGGSVVP
IKTTVGKSTGWMADSPYGLHIALSTKDSAVGELYLDDGHSFQYLHQKQFLHRKLSFSSSV
LINRCADERGHYPSKCKVEQILVLGLQKKPSSVTTHPSDGKVQPAAFTYSARTSTLSLEK
LSLNIGDDWEVHIT
NT seq 2745 nt NT seq  +upstreamnt  +downstreamnt
atggaagcagctgagaaacaggaaatcagtgttgaagatgaagctgtagataaaaccatt
ttcagagactgcaacaagattgctttctacaggcgtcagaaacagcagctctccaagaat
accacctatcaggcattattggagtcagtcacaacaggccaagaaagcaccaagttccaa
atcatcaacaaagcaactaagattcctctcctggctgaaatttatggtatagaaagaaac
attttcagacttaaaatcaatgaagaagctccactgaaaccaaggtatgaggttcccgat
gtcattaccagcaagctaggtgctgtaaggctggtttcatgctcaggggatgcaggcagc
ctgatcctggctaatggaaaaggagatctgaagtgtcatatcacagcaaacccattcaag
atagacttagaatttaagaaagagactgtgctcagcataaattccctgggtcagttatac
tttgaacacctacagattccccagaagcaaagagctaccaaaggaaatgaggagagtaca
gcagctgacacctctcaggaaaatcaagaggatctaggcctttgggaagagaaatttgga
aaatttgtggatgtcaaagctaatggcccttcctctgttggtttggatttctccctgtat
ggatttgaacatctttatggtatcccacaacatgcagaatcacaccaacttaagaatact
agggatggagatgcttaccgcctttataacctggatgtttatggatatcaaatacatgat
aaaatgggcatttatggttcagtgccttatctcctggcccacaaacagggcaggactata
ggcattttctggctgaatgcttcagaaacactagtggagatcaacacagagccagcagta
gagtacacactgacccaggtaggcccagctgctgctaaacagaaagtcggatgtcgaact
gatgtgcgctggatgtcagagagtgggatcattgatgtttttctgctgctgggacctaca
ccttctgacatcttcaagcaatactcttaccttacaggcacacaagccatgccccctctc
ttctccttggggtaccaccagtgccgctggaactatgaggatgagcaggatgtgaaggca
gtggatgcagggtttgatgagcacgacattccatatgatgtcatgtggctggacatagag
cacactgagggcaagaagtacttcacctgggacaaaaaaagatttgcaaaccccaaaagg
atgcaagagctgctcaggagcaaaaaacgaaagcttgtggttatcagtgacccccatatc
aaggttgatcctgactactcagtctatgctaaagccaaggaagaaggcttctttgtgcgg
actccacaaggaggtgactttgaaggagtgtgctggcctggtctctcttcttatctggat
tttaccagtcccaaggtcagagagtggtattcaagtctttttgattttcctgtttatcag
ggatccacggatatccttttcgtatggaatgacatgaatgaaccctcagtctttagaggg
ccagagctaaccatgcaaaagaatgccattcattatggcaactgggaacacagggaactt
cacaatatctatggtttctatcagcagatggctactgcagaaggactgataaagcgatct
caagggaaggagagacccttcgttctttcacgttctttctttgctggatcacaaaagtat
ggtgcggtatggacaggtgacaatacagcagaatggagctacctgaaagtttccatccca
atgctgctcactctgagcatttcagggatctctttttgtggagctgatgtaggcggcttc
attgggaatccagagccagaactgctggtgcgctggtaccaggctggagcttaccagccc
ttcttccgtggccacgctaccatgaacactaagcggcgggaaccctggctctttggggaa
gaacacaccaggctcatccgagaagccatcaaagagcgctacaccctcctgccctatcta
tattctctgttctaccatgcgcacatgtcttctgaacctgtcatgaggcctctgtggata
gagttccctgatgaattagagacttttggtgtggaagatgaatatatgctaggaagcgct
ttattggttcatccagtcacagaactacaggctgccatggttgatgtatttctgccaggg
ccaaatgagatttggtatgactctaaaacatttgctcattggaaaggaggatgtactgtg
aagatcccagtagccttggatactataccagtgtttcagcgaggtggaagtgtggtacca
ataaagacaactgtggggaaatccacaggctggatggctgattccccgtatggactccac
attgctctaagcactaaggattctgctgtgggagaactgtacctcgatgatggtcattca
ttccagtacctccaccagaagcagttcttacaccggaagttgtcattctcttccagtgtt
ttgatcaacaggtgtgctgatgagaggggccattatcccagcaagtgtaaggtagagcag
atcttggtcttaggcctccaaaagaaaccatcttcggtgactacccacccatctgatggt
aaagttcagcctgcagcttttacatactctgccagaacgtccaccctgagtctggagaag
ctttctctgaacattggtgatgactgggaggtccacatcacatga

DBGET integrated database retrieval system