KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103745079
Entry
103745079         CDS       T03372                                 

Gene name
Mdm2
Definition
(RefSeq) MDM2 proto-oncogene
  KO
K06643  E3 ubiquitin-protein ligase Mdm2 [EC:2.3.2.27]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi01522  Endocrine resistance
ngi01524  Platinum drug resistance
ngi04068  FoxO signaling pathway
ngi04110  Cell cycle
ngi04115  p53 signaling pathway
ngi04120  Ubiquitin mediated proteolysis
ngi04144  Endocytosis
ngi04151  PI3K-Akt signaling pathway
ngi04218  Cellular senescence
ngi04625  C-type lectin receptor signaling pathway
ngi04919  Thyroid hormone signaling pathway
ngi05163  Human cytomegalovirus infection
ngi05165  Human papillomavirus infection
ngi05169  Epstein-Barr virus infection
ngi05200  Pathways in cancer
ngi05202  Transcriptional misregulation in cancer
ngi05203  Viral carcinogenesis
ngi05205  Proteoglycans in cancer
ngi05206  MicroRNAs in cancer
ngi05214  Glioma
ngi05215  Prostate cancer
ngi05218  Melanoma
ngi05219  Bladder cancer
ngi05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    103745079 (Mdm2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    103745079 (Mdm2)
   04151 PI3K-Akt signaling pathway
    103745079 (Mdm2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103745079 (Mdm2)
  09143 Cell growth and death
   04110 Cell cycle
    103745079 (Mdm2)
   04115 p53 signaling pathway
    103745079 (Mdm2)
   04218 Cellular senescence
    103745079 (Mdm2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    103745079 (Mdm2)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    103745079 (Mdm2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103745079 (Mdm2)
   05202 Transcriptional misregulation in cancer
    103745079 (Mdm2)
   05206 MicroRNAs in cancer
    103745079 (Mdm2)
   05205 Proteoglycans in cancer
    103745079 (Mdm2)
   05203 Viral carcinogenesis
    103745079 (Mdm2)
  09162 Cancer: specific types
   05214 Glioma
    103745079 (Mdm2)
   05220 Chronic myeloid leukemia
    103745079 (Mdm2)
   05218 Melanoma
    103745079 (Mdm2)
   05219 Bladder cancer
    103745079 (Mdm2)
   05215 Prostate cancer
    103745079 (Mdm2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    103745079 (Mdm2)
   05169 Epstein-Barr virus infection
    103745079 (Mdm2)
   05165 Human papillomavirus infection
    103745079 (Mdm2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    103745079 (Mdm2)
   01522 Endocrine resistance
    103745079 (Mdm2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ngi04131]
    103745079 (Mdm2)
   04121 Ubiquitin system [BR:ngi04121]
    103745079 (Mdm2)
Enzymes [BR:ngi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     103745079 (Mdm2)
Membrane trafficking [BR:ngi04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    103745079 (Mdm2)
Ubiquitin system [BR:ngi04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   MDM2/MDM4 proteins
    103745079 (Mdm2)
SSDB
Motif
Pfam: zf-C3HC4_3 SWIB zf-RanBP DUF4194 zf-RING_2 zf-FPG_IleRS
Other DBs
NCBI-GeneID: 103745079
NCBI-ProteinID: XP_008845193
LinkDB
Position
Un
AA seq 486 aa
MCNTNMSVSTDGAVSTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEIIFYLGQY
IMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVNQQEPSDSAT
SMHENRCHLEGGSDLKDSMPEPQEEKPSSSDSVSRPSTSSRRRAISETEENSDELPGERQ
RKRHRSLSFDESLALCVLREICCERSSSSESTETPSNQDLDDGISEHSGDWLDQESVSDQ
FSVEFEVESLDSEDYSLSEEGQELSDEDDEVYRVTVYQAGESDADSFEEDPEISLADYWK
CTSCKEMNPPLPSHCNRCWALRENWLPEDKGKDKGEISEKVKLESSAHTDEGLDVPDGKK
PTVNDSKESCVEENDKVTESSQSQESEDFSQPSTSGSTIYSSQEEVKEFEKDEAQDKEES
MESSVPLNAIEPCVICQGRPKNGCIVHGKTGHLMSCFTCAKKLKKRNKPCPVCRQPIQMI
VLTYFN
NT seq 1461 nt   +upstreamnt  +downstreamnt
atgtgcaataccaacatgtctgtgtctactgatggtgctgtaagcacctcacagattcca
gcttcggaacaagagactctggttagaccaaagccattgcttttgaagttactaaagtct
gttggtgcccaaaaagatacttatactatgaaagagattatattttatcttggccagtat
attatgactaaaagattatatgatgagaagcagcaacatattgtgtactgttcaaatgat
cttctaggagatttgtttggtgtgccaagcttctctgtgaaagagcacaggaaaatatat
acaatgatctacagaaatttggtggtagtaaatcagcaagaaccgtcagactctgccaca
tctatgcatgagaacaggtgtcatcttgaaggtggaagtgatctaaaggactctatgcca
gagccacaggaagagaagccttcatcttcagattcagtttctagaccatctacctcatct
agaagaagagcaattagtgagacagaagaaaactcagatgaattacccggtgaacgacaa
agaaagcgccacagatctctttcctttgatgaaagcctggctttgtgtgtgttaagggag
atatgctgtgaaagaagcagtagcagtgagtcaacagagactccctcaaatcaggatctc
gacgatggtataagtgaacattctggtgattggttggatcaagaatcagtttctgatcaa
tttagtgtagaatttgaagttgaatctcttgattcagaagattatagtcttagtgaagaa
ggacaagaactctcagatgaagatgatgaggtatatcgagtcacagtgtatcaggcaggg
gaaagtgatgcagattcatttgaggaagatcctgaaatttccttagctgactattggaag
tgtacttcctgcaaggaaatgaatcctcctctcccatcacactgcaacagatgttgggcc
cttcgtgaaaactggcttccagaagataaagggaaagataaaggggaaatctctgaaaaa
gtcaaactagaaagctcagctcatacagatgagggcttggatgtgcctgatggtaaaaaa
cctacagtgaatgattctaaagagtcctgtgttgaggaaaatgataaagtcacagaaagc
tcgcagtcacaagaaagtgaggacttttctcagccatccacttccggtagtactatttat
agcagccaagaagaggtcaaagagtttgagaaggatgaagcccaagacaaagaagaaagt
atggaatctagtgttccccttaatgccattgaaccgtgtgtgatttgccaaggtcgacct
aaaaatggttgcattgttcatggcaaaacgggacatcttatgtcatgcttcacatgtgca
aagaaactaaagaaaaggaataagccctgcccagtgtgcagacaaccaattcaaatgatt
gtgctaacttatttcaactag

DBGET integrated database retrieval system