KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103745571Help
Entry
103745571         CDS       T03372                                 

Gene name
Aldh2
Definition
(RefSeq) aldehyde dehydrogenase 2 family (mitochondrial)
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi00010  Glycolysis / Gluconeogenesis
ngi00053  Ascorbate and aldarate metabolism
ngi00071  Fatty acid degradation
ngi00280  Valine, leucine and isoleucine degradation
ngi00310  Lysine degradation
ngi00330  Arginine and proline metabolism
ngi00340  Histidine metabolism
ngi00380  Tryptophan metabolism
ngi00410  beta-Alanine metabolism
ngi00561  Glycerolipid metabolism
ngi00620  Pyruvate metabolism
ngi01100  Metabolic pathways
Module
ngi_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103745571 (Aldh2)
   00053 Ascorbate and aldarate metabolism
    103745571 (Aldh2)
   00620 Pyruvate metabolism
    103745571 (Aldh2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    103745571 (Aldh2)
   00561 Glycerolipid metabolism
    103745571 (Aldh2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    103745571 (Aldh2)
   00310 Lysine degradation
    103745571 (Aldh2)
   00330 Arginine and proline metabolism
    103745571 (Aldh2)
   00340 Histidine metabolism
    103745571 (Aldh2)
   00380 Tryptophan metabolism
    103745571 (Aldh2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    103745571 (Aldh2)
Enzymes [BR:ngi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     103745571 (Aldh2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh HetR_C
Motif
Other DBs
NCBI-GeneID: 103745571
NCBI-ProteinID: XP_008845744
LinkDB All DBs
Position
Un
AA seq 520 aa AA seqDB search
MLRAAFATARFGPLLGRRLLSAAATSAVPAPNEQPEVFYNQIFINNEWHDAISKKTFPTI
NPSTGEVICQVAEGSKEDVDKAVKAARAAFQLGSPWRRMNASDRGRLLYRLADLIERDRT
YLAALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIEGDFFSYTRHEPVG
VCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNI
VPGFGPTAGAAIASHMDVDKVAFTGSTEVGHLIQNAAGSSNLKRVTLELGGKSPNIILSD
ADMDWAVEQAHFALFFNQGQCCCAGSRTFVHEDVYEEFVERSVVRAKSRVVGNPFDSRTE
QGPQVDETQFKKILGYIKSGEQEGAKLLCGGGAAADRGYFIQPTVFGDVQDGMTIAKEEI
FGPVMQILKFKTIEEVVGRANDSKYGLAAAVFTKDLDKANYLSQALQAGTVWINCYNVFG
AQSPFGGYKMSGSGRELGEYGLQAYTEVKTVTVKVPQKNS
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgcgccgcgttcgccaccgcccgctttggaccgctcctgggccgccgcctgctc
tcggccgccgccaccagcgccgtgccggcccccaacgagcagcccgaggtcttctacaac
cagatcttcataaacaatgaatggcatgatgctatcagcaagaagaccttccccaccatc
aatccatctacgggagaggtcatctgccaggtggcagaaggaagtaaggaagatgtggac
aaggcagtgaaggctgctagggctgccttccagcttggctccccctggcgccgcatgaat
gcatctgacaggggccggctgctgtaccgcctggctgatctcattgagcgggaccggacc
tacctggcagccttggagaccctggacaacggcaagccctatgttatctcctacctggtg
gatttggacatggtcctgaaatgtcttcgttattatgctggctgggctgataagtaccat
gggaaaactattcctatcgagggtgacttcttcagctacactcgccacgagcctgtgggg
gtgtgcgggcagatcattccgtggaacttcccactcctgatgcaagcatggaaactgggt
ccagccttggcaaccggaaacgtggttgtgatgaaggtcgccgagcagacacctctcacc
gccctctacgtggccaacttgatcaaagaggctggcttcccccctggcgtggtcaatatt
gttcccggattcggccccactgctggagctgccatcgcttcccacatggatgtggataaa
gtggcattcacaggctccaccgaggttggccacctaatccagaatgctgcaggcagcagc
aacctcaagagagtaaccctggagctggggggaaagagccccaacatcatcctgtcagat
gctgatatggactgggctgtggaacaggcccacttcgccctgttcttcaaccagggccag
tgctgttgtgccggctcccggacctttgtgcatgaggatgtatacgaagagtttgtggag
cgcagtgttgtccgagccaagtctcgggtggtcgggaacccctttgacagccggacggag
caggggccccaggtggatgagacacagttcaagaagatccttggctatatcaagtcggga
gaacaagagggggcaaagctactgtgcggtgggggtgctgctgctgaccgtggctacttc
atccagcccaccgtgtttggagatgtgcaagacggcatgaccattgcaaaggaggagatc
tttgggccagtgatgcagatcctgaagttcaagaccatagaggaagttgttgggagagcc
aacgattccaagtatgggctggctgcagctgtctttacaaaggacttggacaaagccaat
tatctgtcccaggccctccaggctggcactgtgtggatcaattgctataatgtgtttggg
gcccagtccccatttggaggctataagatgtcggggagtggcagagagctgggcgagtat
ggcctgcaagcatataccgaagtgaagacggtcaccgtcaaagtgcctcagaagaactca
taa

DBGET integrated database retrieval system