KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103745641
Entry
103745641         CDS       T03372                                 

Gene name
E2f3
Definition
(RefSeq) E2F transcription factor 3
  KO
K06620  transcription factor E2F3
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi01522  Endocrine resistance
ngi04110  Cell cycle
ngi04218  Cellular senescence
ngi04934  Cushing syndrome
ngi05160  Hepatitis C
ngi05161  Hepatitis B
ngi05163  Human cytomegalovirus infection
ngi05166  Human T-cell leukemia virus 1 infection
ngi05167  Kaposi sarcoma-associated herpesvirus infection
ngi05169  Epstein-Barr virus infection
ngi05200  Pathways in cancer
ngi05206  MicroRNAs in cancer
ngi05212  Pancreatic cancer
ngi05214  Glioma
ngi05215  Prostate cancer
ngi05218  Melanoma
ngi05219  Bladder cancer
ngi05220  Chronic myeloid leukemia
ngi05222  Small cell lung cancer
ngi05223  Non-small cell lung cancer
ngi05224  Breast cancer
ngi05225  Hepatocellular carcinoma
ngi05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103745641 (E2f3)
   04218 Cellular senescence
    103745641 (E2f3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103745641 (E2f3)
   05206 MicroRNAs in cancer
    103745641 (E2f3)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    103745641 (E2f3)
   05225 Hepatocellular carcinoma
    103745641 (E2f3)
   05226 Gastric cancer
    103745641 (E2f3)
   05214 Glioma
    103745641 (E2f3)
   05220 Chronic myeloid leukemia
    103745641 (E2f3)
   05218 Melanoma
    103745641 (E2f3)
   05219 Bladder cancer
    103745641 (E2f3)
   05215 Prostate cancer
    103745641 (E2f3)
   05224 Breast cancer
    103745641 (E2f3)
   05222 Small cell lung cancer
    103745641 (E2f3)
   05223 Non-small cell lung cancer
    103745641 (E2f3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103745641 (E2f3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103745641 (E2f3)
   05161 Hepatitis B
    103745641 (E2f3)
   05160 Hepatitis C
    103745641 (E2f3)
   05163 Human cytomegalovirus infection
    103745641 (E2f3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103745641 (E2f3)
   05169 Epstein-Barr virus infection
    103745641 (E2f3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103745641 (E2f3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ngi03000]
    103745641 (E2f3)
Transcription factors [BR:ngi03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    103745641 (E2f3)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP
Other DBs
NCBI-GeneID: 103745641
NCBI-ProteinID: XP_008845807
LinkDB
Position
Un
AA seq 460 aa
MRKGIPPALDHYLVTAGGGEGAAVVAAAAAAASMDKRALLASPGFAAAAAAAPGAYIQIL
TTNPSTTSCATSLHGGALAAGPLLPSVAGAEPAAGSLLYTTPHGPSSRAGLQQPPAPGRG
GGGGPPAKRRLELGESGHQYLSDGLKTPKGKGRAALRSPDSPKTPKSPSEKTRYDTSLGL
LTKKFIQLLSQSPDGVLDLNKAAEVLKVQKRRIYDITNVLEGIHLIKKKSKNNVQWMGCS
LSEDGGMLAQCQGLSKEVTELSQEEKKLDELIQSCTLDLKLLTEDSENQRLAYVTYQDIR
KISGLKDQTVIVVKAPPETRLEVPDSIESLQIHLASTQGPIEVYLCPEETETHSPTKTSN
QDHNGNISKPTSKDLASNNSGHSVCPVSTANLSPLASPANLLQQTEDQIPSNLEGPFVSL
LPPLLQEDYLLSLGEEEGISDLFDAYDLEKLPLVEDFMCS
NT seq 1383 nt   +upstreamnt  +downstreamnt
atgagaaaggggatcccgcccgccctggaccactacctggtgaccgccgggggtggggag
ggggcggctgtcgtcgccgccgccgccgccgcagcctccatggacaaaagggcactgcta
gccagtcccggcttcgccgccgccgctgccgccgccccgggcgcgtacatccagatcctc
accacgaacccctccaccacgtcctgtgccacctccctccacggcggcgccctggccgcc
ggccccctgctgcccagtgtcgccggcgcggagccggccgccggcagcctcctctacacc
acgccgcacggaccctccagcagagccgggctgcagcagccaccagcgccgggacgcggc
ggcggcggcggccctccggcaaagcgaaggctggagctgggcgaaagtggccatcagtac
ctctcagatggtctaaaaacccccaagggcaaaggaagagctgcactacggagtcccgat
agtccaaaaactccaaaatctccctcagaaaaaacacgctatgatacgtcactcggtctg
ctcaccaagaagttcattcagctcctgagccagtcacctgacggcgtcttggatttgaac
aaggcagcagaggtgctcaaggtgcagaagagaaggatttacgacatcaccaacgtgctg
gaaggcatccacctcattaagaagaagtctaagaacaacgtccagtggatgggctgcagc
ctgtctgaggatgggggcatgctagcccagtgtcaaggcctgtccaaagaagtgacggag
ctcagtcaggaagagaagaagttagatgagctgatccaaagctgcaccctggacctcaaa
ctgttaaccgaggattcggagaatcaaaggttagcttatgttacatatcaggatattcga
aaaattagtggccttaaagaccaaactgttatagttgtgaaagcccctccagaaacaaga
cttgaagtgcctgactcaatagagagtctacagatacatttggcaagtacccaaggaccc
attgaggtttacttgtgtccagaagagactgaaacacacagtcccacgaaaacaagcaac
caagaccacaatgggaatatctctaagcccacttccaaagacttggcttctaacaactca
ggacatagtgtctgccccgtttctacggcaaatctttctcctctggcctccccagctaat
cttttacagcagactgaggaccaaattccttccaaccttgaaggaccgtttgtgagctta
ctgcctcccctactccaggaggactatctgctgagcctaggggaggaggaaggcatcagc
gatctcttcgatgcttatgatctggaaaagctaccccttgtagaagacttcatgtgtagt
tga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103746411
Entry
103746411         CDS       T03372                                 

Gene name
E2f2
Definition
(RefSeq) E2F transcription factor 2
  KO
K09389  transcription factor E2F2
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi01522  Endocrine resistance
ngi04110  Cell cycle
ngi04218  Cellular senescence
ngi04934  Cushing syndrome
ngi05160  Hepatitis C
ngi05161  Hepatitis B
ngi05163  Human cytomegalovirus infection
ngi05166  Human T-cell leukemia virus 1 infection
ngi05167  Kaposi sarcoma-associated herpesvirus infection
ngi05169  Epstein-Barr virus infection
ngi05200  Pathways in cancer
ngi05206  MicroRNAs in cancer
ngi05212  Pancreatic cancer
ngi05214  Glioma
ngi05215  Prostate cancer
ngi05218  Melanoma
ngi05219  Bladder cancer
ngi05220  Chronic myeloid leukemia
ngi05222  Small cell lung cancer
ngi05223  Non-small cell lung cancer
ngi05224  Breast cancer
ngi05225  Hepatocellular carcinoma
ngi05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103746411 (E2f2)
   04218 Cellular senescence
    103746411 (E2f2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103746411 (E2f2)
   05206 MicroRNAs in cancer
    103746411 (E2f2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    103746411 (E2f2)
   05225 Hepatocellular carcinoma
    103746411 (E2f2)
   05226 Gastric cancer
    103746411 (E2f2)
   05214 Glioma
    103746411 (E2f2)
   05220 Chronic myeloid leukemia
    103746411 (E2f2)
   05218 Melanoma
    103746411 (E2f2)
   05219 Bladder cancer
    103746411 (E2f2)
   05215 Prostate cancer
    103746411 (E2f2)
   05224 Breast cancer
    103746411 (E2f2)
   05222 Small cell lung cancer
    103746411 (E2f2)
   05223 Non-small cell lung cancer
    103746411 (E2f2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103746411 (E2f2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103746411 (E2f2)
   05161 Hepatitis B
    103746411 (E2f2)
   05160 Hepatitis C
    103746411 (E2f2)
   05163 Human cytomegalovirus infection
    103746411 (E2f2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103746411 (E2f2)
   05169 Epstein-Barr virus infection
    103746411 (E2f2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103746411 (E2f2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ngi03000]
    103746411 (E2f2)
Transcription factors [BR:ngi03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    103746411 (E2f2)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP FerA N1221
Other DBs
NCBI-GeneID: 103746411
NCBI-ProteinID: XP_008846813
LinkDB
Position
Un
AA seq 443 aa
MLRGPRTLAPATAPPAVGLRALSPTELWPPGLSSPQPCPAGTTTTTTYYASLYPQTVVPP
TATLGICLDATPHGPEAQVVRCVPEGRLPAKRKLDLEGIGKPSVPEFRTPKGKCIRMDSL
PSPKTPKSPGEKTRYDTSLGLLTKKFIYLLSESEDGVLDLNWAAEVLDVQKRRIYDITNV
LEGIQLIRKKSKNNIQWVGRGLFEDPSRPAKQQQLGQELKELMNTEKTLDQLIQSCSMTF
KRLTEDKANKKLAYVTYQDIRAVGNFKDQTVIVVKAPPQTRLEVPDRAEENLQIYLKSTQ
GPIEVYLCPEEVQEPESPAKEPLTSTSVLSPSPDSVQLSSNMDPEITENIESSVMSPAPS
CMVPPPPAPSLVPLEATDNMLELSHPLLQQTEDQFLSPNMACSSPLISFSPPLDQDDYLW
GMDEGEGISDLFDSYDLGDLLIN
NT seq 1332 nt   +upstreamnt  +downstreamnt
atgctgcgcgggccgcggaccctggctccggccaccgcgccgcctgcagtggggttgcgg
gctctgagccctacggaattgtggcctcctggcctcagcagcccccagccgtgccccgcc
ggcaccaccaccaccaccacctactacgcctcgctttacccgcagacagtggtgcctccc
actgcaaccctgggcatctgcctggacgccaccccccacggacccgaggcccaagttgtg
cgatgtgtgccggaaggccggctgccggccaaaaggaagctggacttggagggcatcggg
aagccttcggtccctgagttccggactcccaaagggaaatgcatccgaatggatagcctg
cccagccccaaaacccccaagtctcctggggagaagacccggtatgacacgtctctgggg
ctgctcaccaagaagttcatttatctcctgagtgagtcggaggatggggtcctggacctg
aactgggcagccgaggtgctggatgtgcagaagcggcgcatctatgacatcaccaacgtg
ctggagggcatccaactcatccgcaagaagtccaagaacaacatccagtgggtaggcagg
ggactatttgaagacccctcccgacctgcaaagcagcagcagctggggcaggagctgaag
gagctgatgaacacagagaagaccttggaccagctcatccagagctgctcaatgacgttc
aagcgtctgacggaggataaggccaataagaaactggcctatgtgacttaccaggacatc
cgagctgtgggcaactttaaggaccagactgtgattgtggtgaaggcccctccacagacc
agactagaagtgccggacagggctgaggagaacctacagatatatctaaagagcacccaa
gggcccattgaagtctacctatgtccggaggaagtgcaagagccagaaagtcctgccaag
gagcccctcacctccacctctgtcctgagccccagtcccgacagtgtccagctcagcagc
aacatggaccctgagatcacagagaacatcgagtcctcagttatgtctccagccccaagc
tgtatggtcccaccaccaccagcgccatcccttgtccccttggaagctactgacaacatg
ctggagctgtcgcatccacttctgcagcagacagaggaccagttcctgtccccaaacatg
gcctgcagctcccctctgatcagcttctccccacccttggaccaggatgactacctgtgg
ggcatggatgagggtgagggcatcagtgacctcttcgactcctatgaccttggagatctg
ctgattaattga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103751571
Entry
103751571         CDS       T03372                                 

Gene name
E2f1
Definition
(RefSeq) E2F transcription factor 1
  KO
K17454  transcription factor E2F1
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi01522  Endocrine resistance
ngi04110  Cell cycle
ngi04137  Mitophagy - animal
ngi04218  Cellular senescence
ngi04934  Cushing syndrome
ngi05160  Hepatitis C
ngi05161  Hepatitis B
ngi05163  Human cytomegalovirus infection
ngi05165  Human papillomavirus infection
ngi05166  Human T-cell leukemia virus 1 infection
ngi05167  Kaposi sarcoma-associated herpesvirus infection
ngi05169  Epstein-Barr virus infection
ngi05200  Pathways in cancer
ngi05206  MicroRNAs in cancer
ngi05212  Pancreatic cancer
ngi05214  Glioma
ngi05215  Prostate cancer
ngi05218  Melanoma
ngi05219  Bladder cancer
ngi05220  Chronic myeloid leukemia
ngi05222  Small cell lung cancer
ngi05223  Non-small cell lung cancer
ngi05224  Breast cancer
ngi05225  Hepatocellular carcinoma
ngi05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    103751571 (E2f1)
  09143 Cell growth and death
   04110 Cell cycle
    103751571 (E2f1)
   04218 Cellular senescence
    103751571 (E2f1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103751571 (E2f1)
   05206 MicroRNAs in cancer
    103751571 (E2f1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    103751571 (E2f1)
   05225 Hepatocellular carcinoma
    103751571 (E2f1)
   05226 Gastric cancer
    103751571 (E2f1)
   05214 Glioma
    103751571 (E2f1)
   05220 Chronic myeloid leukemia
    103751571 (E2f1)
   05218 Melanoma
    103751571 (E2f1)
   05219 Bladder cancer
    103751571 (E2f1)
   05215 Prostate cancer
    103751571 (E2f1)
   05224 Breast cancer
    103751571 (E2f1)
   05222 Small cell lung cancer
    103751571 (E2f1)
   05223 Non-small cell lung cancer
    103751571 (E2f1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103751571 (E2f1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103751571 (E2f1)
   05161 Hepatitis B
    103751571 (E2f1)
   05160 Hepatitis C
    103751571 (E2f1)
   05163 Human cytomegalovirus infection
    103751571 (E2f1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103751571 (E2f1)
   05169 Epstein-Barr virus infection
    103751571 (E2f1)
   05165 Human papillomavirus infection
    103751571 (E2f1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103751571 (E2f1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ngi03000]
    103751571 (E2f1)
Transcription factors [BR:ngi03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    103751571 (E2f1)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP DUF4455 Spc7 TP1
Other DBs
NCBI-GeneID: 103751571
NCBI-ProteinID: XP_008853281
LinkDB
Position
Un
AA seq 404 aa
MVHEKLQTHLECQAPAPRRPPPPVAGPRDPEVLLFATPQAPRAAPSAPRPALGRPPVKRR
LDLETDHQYLAESSGPFRGRGRHPGKGVKSPGEKSRYETSLNLTTKRFLELLSHSADGVV
DLNWAAEVLKVQKRRIYDITNVLEGIQLIAKKSKNHIQWLGSHTMVGISKRLEGLNKDLQ
QLQESEQQLDHLMDICTTQLQLLSEDSDSQRLAYVTCQDLRSIADPAEQMIMVIKAPPET
QLQAVDSAETFQISLKSKQGPIDVFLCPEESAGGISPGRTPSQEESGEEDRTTDPGSAGP
LPSSPTTSPTLDPSQSLLGMEQEPVPSRMGNLRAPMEEDRLSPLVAADLLLEHVREDFSG
LLPEEFITLSPPHEALDYHFGLEESEGIRDLFDCDFGDLTPLDF
NT seq 1215 nt   +upstreamnt  +downstreamnt
atggtacacgagaagttgcagacccatctggaatgtcaggcgccggcgccccgcaggccc
ccgccgccggtcgccggcccccgtgaccccgaagtgctgctgttcgccacgcctcaggcg
ccccgggccgcacccagcgcgccgcgccccgctctcggccgcccgccggtgaagcggaga
ctggatctggaaactgaccatcagtacctggctgagagcagtggaccattccggggcaga
ggccgccacccaggaaaaggtgtgaaatctccaggggagaagtcacgctatgagacatca
ctaaatctgaccaccaaacgcttcttggagctgctaagccactcagctgatggtgttgtt
gacctgaactgggctgctgaggtgctgaaggtgcagaaacggcgcatctacgacatcacc
aatgtcctcgagggtatccagctcattgccaagaagtctaagaaccatatccagtggcta
ggcagccacaccatggtggggatcagtaagcggcttgaaggtctgaacaaggacctccag
caactgcaggagagtgagcagcagctggatcacctgatggacatctgtaccacacagctg
caactgctttctgaggattctgacagccagcgcctggcctatgtgacctgccaggacctt
cgcagcattgcagaccctgcagaacagatgatcatggtgatcaaggcccctcccgagacc
caactccaagctgtggactctgctgagacatttcagatctcccttaagagcaaacaaggc
cccatcgatgttttcctgtgccctgaggagagtgcaggggggatcagccctgggaggacc
ccatcccaggaagaatctggggaggaagacaggaccactgaccctggcagtgcagggcct
cttccatcatctcccaccacatcccccacgttggatcccagccagtccctgctcggcatg
gagcaagagccagtgccgtcacggatgggcaatctgagggcccccatggaagaagaccgt
ctgtctccactcgtggctgctgacttgcttctggagcatgtacgagaagacttctctggg
ctcctccctgaggagtttatcactctttccccacctcatgaggccctggactaccacttt
ggcctcgaggagagtgagggcatcagagatctttttgactgtgactttggggacctgact
cccctggatttctga

DBGET integrated database retrieval system