KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103745757
Entry
103745757         CDS       T03372                                 

Gene name
Esr1
Definition
(RefSeq) estrogen receptor 1
  KO
K08550  estrogen receptor alpha
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi01522  Endocrine resistance
ngi04915  Estrogen signaling pathway
ngi04917  Prolactin signaling pathway
ngi04919  Thyroid hormone signaling pathway
ngi04961  Endocrine and other factor-regulated calcium reabsorption
ngi05200  Pathways in cancer
ngi05205  Proteoglycans in cancer
ngi05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    103745757 (Esr1)
   04917 Prolactin signaling pathway
    103745757 (Esr1)
   04919 Thyroid hormone signaling pathway
    103745757 (Esr1)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    103745757 (Esr1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103745757 (Esr1)
   05205 Proteoglycans in cancer
    103745757 (Esr1)
  09162 Cancer: specific types
   05224 Breast cancer
    103745757 (Esr1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103745757 (Esr1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ngi03000]
    103745757 (Esr1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:ngi03310]
    103745757 (Esr1)
Transcription factors [BR:ngi03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    103745757 (Esr1)
Nuclear receptors [BR:ngi03310]
 3. Estrogen like
  3A. Estrogen receptor
   103745757 (Esr1)
SSDB
Motif
Pfam: Oest_recep Hormone_recep zf-C4 ESR1_C
Other DBs
NCBI-GeneID: 103745757
NCBI-ProteinID: XP_008845967
LinkDB
Position
Un
AA seq 590 aa
MTLHAKASGMALLHQIQGKELESLSRQQLKMPLERAMGEVYVDSSKPAVFNYPEGAAYDF
NAAAASAPVYGQPGLTYGPGSEAAAFSANSLGGFPQLNSVSPNPLMLLHPPPQLSPFLHP
HGQQVPYYLENEPSGYSVRDAGPPAFYRSNSDNRRQSGRERLSGSNEKGSMESAKETRYC
AVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQACRLRKC
YEVGMMKGGIRKDRRGGRMLKHKRQRDDLEGRNEMGPSGNMRAANLWPSPLMIKHTKKTS
PALSLTADQMVSALLDAEPPLIYSEYDPSRPFSEASMMGLLTNLADRELVHMINWAKRVP
GFGDLNLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGLVELF
DMLLATSSQFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDT
LIHLMAKAGLTLQQQHRRLAQLLLILSHIRHMSNKGMEHLYNMKCKNIVPLYDLLLEMLD
AHRLHTPTSRMGVPSEEPSQSQLTTTSSTSAHSLQTYYIPQEAEGFPSTI
NT seq 1773 nt   +upstreamnt  +downstreamnt
atgacccttcacgccaaagcctcgggaatggccttgctccatcagatccaaggcaaagag
ctggagtccctcagccgccagcagctcaagatgcccctggagcgggccatgggcgaggtg
tacgtggacagcagcaagcccgcggtgttcaactaccctgagggcgcagcctacgacttc
aacgcagctgccgcctccgcgccggtctacggccagccgggcctcacctacggccctggg
tccgaggctgcggcgttcagtgccaatagcctggggggcttcccccagctcaacagcgtg
tcgcccaacccgctgatgctgctgcacccgccgccgcagctgtcgcccttcctgcacccg
cacggccagcaggtgccctactacctggagaatgagcccagcggctactctgtgcgtgat
gcgggtccgcctgcgttctacaggtccaactcagataaccgacgccagagtggccgagag
agactgtctggcagcaatgagaaggggagcatggagtcagccaaggagacacgttactgt
gcagtgtgcaatgactatgcatcaggctaccattatggggtgtggtcctgtgagggctgc
aaggctttcttcaagagaagtattcaagggcataacgactacatgtgtccagctactaac
cagtgcactatcgacaagaacaggaggaaaagctgccaggcctgccggctgcgcaaatgc
tacgaagtgggcatgatgaaaggtgggatacggaaagacagaagaggggggagaatgttg
aaacacaagcgtcagagagatgacttggaaggcagaaacgaaatggggccctcaggcaac
atgagagcagccaacctttggccgagcccgctcatgatcaagcacactaagaagaccagc
ccagccttgtccttgacagcagatcagatggtcagtgccttgttggatgctgaacccccc
ttaatctattctgagtatgatccttctagacccttcagtgaagcttcgatgatgggctta
ttgaccaatctggcagacagggagctggttcatatgatcaactgggcgaagcgagtgcca
ggctttggggacttaaacctgcatgatcaggtccaccttctggaatgtgcctggctagag
attctgatgattggtcttgtctggcgctccatggaacacccagggaagctcctgttcgct
cccaacttgctcttggacaggaatcaaggtaaatgtgtagagggcttggtggagctcttc
gacatgttgctggcgacgtcgtctcagttccgtatgatgaatcttcagggagaggagttt
gtgtgcctcaaatctatcattttgcttaattctggagtgtacacatttctgtctagcacc
cttaagtccctggaagagaaagaccacatccaccgggtcttggataagatcacagacacc
ttgattcatctgatggccaaagcaggcctgactctgcagcagcagcaccgtcgcctggcc
cagctcctgctcatcctctcccacatccggcatatgagtaacaaaggcatggaacatctg
tacaacatgaagtgcaagaacatcgttcccctctatgacttgttgctggagatgctggat
gcccaccgtctgcacactccgacaagccgcatgggagtcccctcagaggagcccagccag
agccagctgaccactaccagttcgacttcagcacattccttgcaaacttactacatcccc
caggaagcagagggtttccccagcacaatctga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103747954
Entry
103747954         CDS       T03372                                 

Gene name
Esr2
Definition
(RefSeq) estrogen receptor 2
  KO
K08551  estrogen receptor beta
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi01522  Endocrine resistance
ngi04915  Estrogen signaling pathway
ngi04917  Prolactin signaling pathway
ngi04929  GnRH secretion
ngi05200  Pathways in cancer
ngi05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    103747954 (Esr2)
   04915 Estrogen signaling pathway
    103747954 (Esr2)
   04917 Prolactin signaling pathway
    103747954 (Esr2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103747954 (Esr2)
  09162 Cancer: specific types
   05224 Breast cancer
    103747954 (Esr2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103747954 (Esr2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ngi03000]
    103747954 (Esr2)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:ngi03310]
    103747954 (Esr2)
Transcription factors [BR:ngi03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    103747954 (Esr2)
Nuclear receptors [BR:ngi03310]
 3. Estrogen like
  3A. Estrogen receptor
   103747954 (Esr2)
SSDB
Motif
Pfam: ERbeta_N Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 103747954
NCBI-ProteinID: XP_008848708
LinkDB
Position
Un
AA seq 567 aa
MSTCASFHKEFSQLLPVQDMDIKNSPSSLNSPASYNCSQSILPLEHGSIYIPSSYVDSRH
EYSAMTFYSPTVMNYSVPNSGNNPEGGSVRQTVSPGVLWPTPGHLSPLAIHCQSSLLYAE
PQKSPWCESRSLEHPLPVNRETLKRKVSGSSCASPVTSPSSKRDAHFCAVCSDYASGYHY
GVWSCEGCKAFFKRSIQGHNDYICPATNQCTIDRNRRKSCQACRLRKCYEVGMVKCGSRR
ERCGYRVVRRQRTPAEHLHCLSKSKKNSGHVPRVKELLLSALSPEQLVLTLLEAEPPHVL
VSRPSMPFTEASMMMSLTKLADKELVHMIGWAKKIPGFVELSLLDQVRLLESCWMEVLMV
GLMWRSIDHPGKLIFAPDLVLDRSSEDPHWHVAQMKSPAPRDEGKCVEGILEIFDMLLAT
TSRFRELKLQHKEYLCVKAMILLNSSMYPLATASQEAESSQKLTHLLNSVTDALVWVIAK
SGISSQQQSVRLANLLMLLSHVRHISNKGMEHLLSMKCKNVVPVYDLLLEMLNAHTLRGY
KSSVSGPECSSVEDSKSKEGSQNTQPQ
NT seq 1704 nt   +upstreamnt  +downstreamnt
atgtccacttgtgcctcttttcacaaggagttttctcagctgctacctgttcaagacatg
gatataaaaaattcaccatcgagccttaattctcctgcttcttacaactgtagtcagtct
atcctaccgctggagcatggttccatctacatcccttcctcctatgtagacagccgccat
gaatactcagctatgacattctatagtcctactgtgatgaactacagcgttcccaacagt
ggcaataacccagaaggggggtctgttagacagaccgtgagtccaggtgtgttatggcca
actcctgggcacctctctcctttagccatccactgccagtcgtcacttctgtatgcagaa
cctcagaagagtccttggtgtgaatcaagatcactggaacaccccttacctgtgaacaga
gagacactgaaaaggaaggttagtgggagcagttgtgccagccccgtaactagtccaagt
tcaaagagggacgctcacttctgtgcagtctgcagtgactatgcatctgggtatcactat
ggtgtctggtcatgtgaaggatgcaaggcctttttcaaaagaagcattcaaggacataat
gattatatttgtccagctacaaatcagtgtaccatagacaggaaccggcgtaaaagctgc
caggcctgccgactccggaagtgctatgaagtaggaatggtcaagtgtggctcccggagg
gaaaggtgtgggtaccgtgtagtgcgaagacagagaacccccgctgagcacctgcactgc
ctaagcaaatccaagaaaaacagtgggcatgtgccccgagtgaaggagcttctactgagc
gccctgagcccagagcagctggtgctcactctcctggaggcagagccaccccatgtgcta
gtgagccgccccagcatgcccttcaccgaggcctccatgatgatgtccctcaccaagctg
gctgataaggaactggtgcacatgatcggctgggccaagaaaatcccgggctttgtggag
ctcagcttgttggaccaagtgcggctcttggagagctgctggatggaggtgttaatggtg
gggctgatgtggcgctccatcgaccaccctggcaagctcatctttgctccagatctcgtt
ctggataggtcatcagaagaccctcactggcacgttgcgcagatgaagagccctgcccca
agggatgaggggaaatgcgtagaaggaattctggaaatctttgacatgctcctggcaacg
acttcaaggtttcgtgagttaaaactccagcacaaagaatatctctgtgtcaaggccatg
atcctcctcaactccagtatgtaccctttggctacagcaagccaggaggcagagagcagc
cagaagctgacccacctactgaactctgtgacagatgctctggtctgggtgatcgccaag
agcggcatctcttcccagcagcagtcggttcgcctggctaacctcctgatgctcctctct
catgtcaggcacatcagtaacaagggcatggaacatctgctcagcatgaagtgtaaaaat
gtggtcccagtttatgacctgctgctggagatgctgaatgcccacacgcttcgagggtac
aagtcctcagtctcggggcccgagtgcagctcagtggaggacagtaaaagcaaagaaggc
tcccagaacacacagccccagtga

DBGET integrated database retrieval system