KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103745898
Entry
103745898         CDS       T03372                                 

Gene name
Bid
Definition
(RefSeq) BH3 interacting domain death agonist
  KO
K04726  BH3 interacting domain death agonist
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi01524  Platinum drug resistance
ngi04071  Sphingolipid signaling pathway
ngi04115  p53 signaling pathway
ngi04210  Apoptosis
ngi04215  Apoptosis - multiple species
ngi04217  Necroptosis
ngi04650  Natural killer cell mediated cytotoxicity
ngi04932  Non-alcoholic fatty liver disease
ngi05010  Alzheimer disease
ngi05014  Amyotrophic lateral sclerosis
ngi05022  Pathways of neurodegeneration - multiple diseases
ngi05152  Tuberculosis
ngi05160  Hepatitis C
ngi05161  Hepatitis B
ngi05162  Measles
ngi05163  Human cytomegalovirus infection
ngi05164  Influenza A
ngi05167  Kaposi sarcoma-associated herpesvirus infection
ngi05168  Herpes simplex virus 1 infection
ngi05169  Epstein-Barr virus infection
ngi05170  Human immunodeficiency virus 1 infection
ngi05200  Pathways in cancer
ngi05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    103745898 (Bid)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    103745898 (Bid)
   04215 Apoptosis - multiple species
    103745898 (Bid)
   04217 Necroptosis
    103745898 (Bid)
   04115 p53 signaling pathway
    103745898 (Bid)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    103745898 (Bid)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103745898 (Bid)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103745898 (Bid)
   05014 Amyotrophic lateral sclerosis
    103745898 (Bid)
   05022 Pathways of neurodegeneration - multiple diseases
    103745898 (Bid)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    103745898 (Bid)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    103745898 (Bid)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    103745898 (Bid)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103745898 (Bid)
   05161 Hepatitis B
    103745898 (Bid)
   05160 Hepatitis C
    103745898 (Bid)
   05164 Influenza A
    103745898 (Bid)
   05162 Measles
    103745898 (Bid)
   05168 Herpes simplex virus 1 infection
    103745898 (Bid)
   05163 Human cytomegalovirus infection
    103745898 (Bid)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103745898 (Bid)
   05169 Epstein-Barr virus infection
    103745898 (Bid)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    103745898 (Bid)
SSDB
Motif
Pfam: BID MOR2-PAG1_C
Other DBs
NCBI-GeneID: 103745898
NCBI-ProteinID: XP_008846132
LinkDB
Position
Un
AA seq 196 aa
MDSEVSNGSGLEAEHLTDLLVFGFLQSYSDYSFYQELEALGQKLPVRVYLQDQDDELQTD
GNRASRYFSQERIEPDSESQEEIIQNIARHLAQVGDEMDHSIHPTLVRHLAAQFMNRNLS
EEDRRNCLATALEEIRKTYPKDMETEKAALIMTMLLAKKVADFRPSLLHDVFRTTVNFIN
QNLFTYVRNLVRNGMN
NT seq 591 nt   +upstreamnt  +downstreamnt
atggactctgaggtcagcaacggctcaggcctggaagctgagcacctcacagacctgctt
gtgtttggcttcctccaaagctactctgactatagtttctaccaagagctggaggcactg
ggccagaaactgcccgtgcgagtttacctgcaggaccaggacgatgagctgcagactgat
gggaaccgggccagccgctacttctcccaggaaagaatagagccagattctgaaagtcag
gaagaaatcatccagaacattgccaggcatctcgctcaagtaggggatgagatggaccac
agcatccatccgacactggtgagacacctggctgcacagttcatgaacaggaacctgtca
gaggaagacagaaggaactgcctggcaacagccctagaggagataaggaagacctaccct
aaagacatggagactgagaaggctgcactgataatgaccatgctattggccaaaaaagtg
gctgatttcaggccatccttgctccatgatgtctttcgcacaacagtgaactttattaac
cagaacctattcacctatgtgaggaacttagtcagaaatggcatgaactga

DBGET integrated database retrieval system