KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103746460
Entry
103746460         CDS       T03372                                 

Gene name
Adcy3
Definition
(RefSeq) adenylate cyclase 3
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi00230  Purine metabolism
ngi01100  Metabolic pathways
ngi01522  Endocrine resistance
ngi04015  Rap1 signaling pathway
ngi04020  Calcium signaling pathway
ngi04022  cGMP-PKG signaling pathway
ngi04024  cAMP signaling pathway
ngi04062  Chemokine signaling pathway
ngi04072  Phospholipase D signaling pathway
ngi04114  Oocyte meiosis
ngi04211  Longevity regulating pathway
ngi04213  Longevity regulating pathway - multiple species
ngi04261  Adrenergic signaling in cardiomyocytes
ngi04270  Vascular smooth muscle contraction
ngi04371  Apelin signaling pathway
ngi04540  Gap junction
ngi04611  Platelet activation
ngi04713  Circadian entrainment
ngi04714  Thermogenesis
ngi04723  Retrograde endocannabinoid signaling
ngi04724  Glutamatergic synapse
ngi04725  Cholinergic synapse
ngi04727  GABAergic synapse
ngi04740  Olfactory transduction
ngi04750  Inflammatory mediator regulation of TRP channels
ngi04911  Insulin secretion
ngi04912  GnRH signaling pathway
ngi04913  Ovarian steroidogenesis
ngi04914  Progesterone-mediated oocyte maturation
ngi04915  Estrogen signaling pathway
ngi04916  Melanogenesis
ngi04918  Thyroid hormone synthesis
ngi04921  Oxytocin signaling pathway
ngi04923  Regulation of lipolysis in adipocytes
ngi04925  Aldosterone synthesis and secretion
ngi04926  Relaxin signaling pathway
ngi04927  Cortisol synthesis and secretion
ngi04928  Parathyroid hormone synthesis, secretion and action
ngi04934  Cushing syndrome
ngi04935  Growth hormone synthesis, secretion and action
ngi04962  Vasopressin-regulated water reabsorption
ngi04970  Salivary secretion
ngi04971  Gastric acid secretion
ngi04972  Pancreatic secretion
ngi04976  Bile secretion
ngi05032  Morphine addiction
ngi05163  Human cytomegalovirus infection
ngi05166  Human T-cell leukemia virus 1 infection
ngi05200  Pathways in cancer
ngi05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    103746460 (Adcy3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    103746460 (Adcy3)
   04371 Apelin signaling pathway
    103746460 (Adcy3)
   04020 Calcium signaling pathway
    103746460 (Adcy3)
   04072 Phospholipase D signaling pathway
    103746460 (Adcy3)
   04024 cAMP signaling pathway
    103746460 (Adcy3)
   04022 cGMP-PKG signaling pathway
    103746460 (Adcy3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103746460 (Adcy3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103746460 (Adcy3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103746460 (Adcy3)
   04062 Chemokine signaling pathway
    103746460 (Adcy3)
  09152 Endocrine system
   04911 Insulin secretion
    103746460 (Adcy3)
   04923 Regulation of lipolysis in adipocytes
    103746460 (Adcy3)
   04912 GnRH signaling pathway
    103746460 (Adcy3)
   04913 Ovarian steroidogenesis
    103746460 (Adcy3)
   04915 Estrogen signaling pathway
    103746460 (Adcy3)
   04914 Progesterone-mediated oocyte maturation
    103746460 (Adcy3)
   04921 Oxytocin signaling pathway
    103746460 (Adcy3)
   04926 Relaxin signaling pathway
    103746460 (Adcy3)
   04935 Growth hormone synthesis, secretion and action
    103746460 (Adcy3)
   04918 Thyroid hormone synthesis
    103746460 (Adcy3)
   04928 Parathyroid hormone synthesis, secretion and action
    103746460 (Adcy3)
   04916 Melanogenesis
    103746460 (Adcy3)
   04925 Aldosterone synthesis and secretion
    103746460 (Adcy3)
   04927 Cortisol synthesis and secretion
    103746460 (Adcy3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103746460 (Adcy3)
   04270 Vascular smooth muscle contraction
    103746460 (Adcy3)
  09154 Digestive system
   04970 Salivary secretion
    103746460 (Adcy3)
   04971 Gastric acid secretion
    103746460 (Adcy3)
   04972 Pancreatic secretion
    103746460 (Adcy3)
   04976 Bile secretion
    103746460 (Adcy3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    103746460 (Adcy3)
  09156 Nervous system
   04724 Glutamatergic synapse
    103746460 (Adcy3)
   04727 GABAergic synapse
    103746460 (Adcy3)
   04725 Cholinergic synapse
    103746460 (Adcy3)
   04723 Retrograde endocannabinoid signaling
    103746460 (Adcy3)
  09157 Sensory system
   04740 Olfactory transduction
    103746460 (Adcy3)
   04750 Inflammatory mediator regulation of TRP channels
    103746460 (Adcy3)
  09149 Aging
   04211 Longevity regulating pathway
    103746460 (Adcy3)
   04213 Longevity regulating pathway - multiple species
    103746460 (Adcy3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103746460 (Adcy3)
   04714 Thermogenesis
    103746460 (Adcy3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103746460 (Adcy3)
  09165 Substance dependence
   05032 Morphine addiction
    103746460 (Adcy3)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    103746460 (Adcy3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103746460 (Adcy3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103746460 (Adcy3)
   05163 Human cytomegalovirus infection
    103746460 (Adcy3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103746460 (Adcy3)
Enzymes [BR:ngi01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     103746460 (Adcy3)
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA NCE101 Peptidase_S49_N
Other DBs
NCBI-GeneID: 103746460
NCBI-ProteinID: XP_008846872
LinkDB
Position
Un
AA seq 1144 aa
MPRNQGFSDPEYSAEYSAEYSVSLPSDPDRGVGRTHEISVRNSGSCLCLPRFMRLTFVPE
SLENLYQTYFKRQRHETLLVLVVFAALFDCYVVVMCAVVFSSDKLAPLVVAGIGLVLDII
LFVLCKKGLLPDRVSRKVVPYLLWLLITAQIFSYLGLNFSRAHAASDTVGWQTFFVFSFF
ITLPLSLSPIVIISVVSCVVHTLVLGVTVAQQQQEELQGMQLLREILANVFLYLCAIIVG
IMSYYMADRKHRKAFLEARQSLEVKMNLEEQSQQQENLMLSILPKHVADEMLKDMKKDES
QKDQQQFNTMYMYRHENVSILFADIVGFTQLSSACSAQELVKLLNELFARFDKLAAKYHQ
LRIKILGDCYYCICGLPDYREDHAVCSILMGLAMVEAISYVREKTKTGVDMRVGVHTGTV
LGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQSTMDCLKGEFDVEPGDGGSRCD
YLEEKGIETYLIIASKPEVKKTAQNGLNGSALPNGAPMSSKPSSPALIETKEPNGSTHAS
GSMSEEAEEQEAQADNPSFPNPRRRLRLQDLADRVVDASEDEHELNQLLNEALLERESAQ
VVKKRNTFLLTMRFMDPEMETRYSVEKEKQSGAAFSCSCVVLFCTAMVEILIDPWLMTNY
VTFVVGEVLLLILTICSLAAIFPRAFPKKLVAFSSWIDRTRWARNTWAMLAIFILVMTNV
VDVLSCLQYYMGPYNGTAGIELDGGCLENPKYYNYVAVLSLIATIMLVQVSHMVKLTLML
LVTGAVTAINLYAWCPVFDEYDHKRFQEHDSPMVALEKMQVFSTPGLNGTDRLSLMPSKY
SMTVMMFIMMLSFYYFSRHVEKLARTLFLWKIEVHDQKERVYEMRRWNEALVTNMLPEHV
ARHFLGSKKRDEELYSQSYDEIGVMFASLPNFADFYTEESINNGGIECLRFLNEIISDFD
SLLDNPKFRVITKIKTIGSTYMAASGVTPDVNTNGFTSSSKEEKSDKERWQHLADLADFA
LAMKDTLTNINNQSFNNFMLRIGMNKGGVLAGVIGARKPHYDIWGNTVNVASRMESTGVM
GNIQVVEETQVILREYGFRFVRRGPIFVKGKGELLTFFLKGRDRPAAFPNGSSVTLPHQV
VDNS
NT seq 3435 nt   +upstreamnt  +downstreamnt
atgccgaggaaccagggcttctcagatcccgagtactcggcagagtactcagccgagtac
tccgtcagcctcccctcagaccctgaccgcggggttggccggacccatgaaatctccgtg
cggaactcgggatcctgcctgtgcctgccgcgcttcatgcggctgaccttcgtgccagag
tccttagagaacctctaccagacctacttcaagaggcagcgccatgagacgctgctggtc
ttggtggtcttcgcagccctcttcgactgctacgtggtggtcatgtgcgctgtggtcttc
tccagcgacaagctagctcccctcgtcgtggctgggatcgggctggtgttggacatcatc
ctctttgtgctctgcaaaaaggggctcctcccggaccgcgtgagccggaaggtggtaccc
tacctgctgtggctgctcatcacagctcagatcttctcctacctgggcctgaacttctcc
cgtgcccatgcagccagcgacactgtgggctggcagaccttctttgtcttttctttcttt
atcacgttgcccctcagcctcagccccatcgtgatcatctctgtggtctcctgtgttgtg
cacacgctggtcttgggggtcaccgtggctcagcagcagcaggaggagcttcaagggatg
cagctgctgagggagatcctggccaatgtcttcctctacttgtgcgccatcatcgtgggc
atcatgtcctactacatggcagaccgcaagcaccgtaaagccttcctggaggcccgccag
tcactggaggtgaagatgaacctggaggagcagagccagcaacaggagaaccttatgctt
tccatcctgcccaagcatgtggctgatgagatgttgaaggacatgaagaaagatgagagc
cagaaggaccagcagcagttcaacaccatgtacatgtaccggcatgagaacgtcagcatc
ctgtttgcagatattgtgggtttcacccagctgtcctctgcctgcagtgcccaggagctc
gtaaaactactcaacgagctctttgcccgctttgacaagctggcggctaaataccaccag
ctgcggatcaagatcctgggagactgttactactgcatctgtgggctgccggactaccgg
gaggaccatgctgtgtgctccatcctcatgggcctcgccatggtggaggccatctcgtat
gtgcgggagaagaccaagacgggagtggacatgcgtgtgggggtacacacaggcactgtg
ctaggtggcgtcctgggccagaaacggtggcagtatgatgtgtggtccactgatgtcact
gtggctaacaagatggaggctggaggtattccagggcgagtgcacatctctcagagcacc
atggactgcctgaaaggggagtttgacgtggagcctggtgatgggggcagccgctgtgat
tacctagaggagaagggcatcgaaacctacctcatcattgcctccaagccagaggtgaag
aaaactgcccagaatggtctcaatggctcggccctgccaaatggagccccaatgtcctcc
aagcccagctcccctgcccttattgagaccaaggaacccaatgggagcacccatgccagc
ggctccatgtcggaggaggctgaggagcaggaggcccaggccgacaacccctcgttcccc
aacccccgccgcaggctgcgcctccaggacctggcagaccgtgtggtggatgcctctgag
gatgagcacgagctcaatcagctgctcaacgaggccttgctggagcgggaatctgcccag
gtggtgaagaagagaaacaccttcctcctgaccatgcggttcatggaccctgagatggaa
acacgctactctgtggagaaggagaagcagagcggggccgccttcagctgctcctgtgtc
gtcctgttctgcacagctatggtggagatcctcattgacccctggctcatgacaaactac
gtgacctttgtggttggggaggtactgctcctgatcctgaccatctgctcactggctgcc
atctttcctagggcctttcctaagaagcttgtggccttttcatcttggatcgaccggaca
cgctgggccaggaacacctgggccatgttagccattttcattctagtcatgaccaatgtt
gtggacgtgcttagctgtctccaatactacatgggaccctacaatgggacagctgggata
gagctggatggtggctgtctggagaaccccaagtattacaactacgttgctgtgctgtcc
ctcatcgccaccatcatgctagtgcaggtcagccacatggtgaagctgacgctcatgcta
ctcgtcactggcgcggtgactgccatcaacctctatgcctggtgtcccgtctttgatgaa
tacgaccacaaacgctttcaggaacatgactctcctatggtggctttagagaagatgcag
gtattttctaccccagggctcaatggcactgacaggctgtccctgatgccttctaagtac
tcaatgacagtgatgatgttcatcatgatgctgagcttttactacttctcccgccacgtg
gaaaaactggctcggacactgttcctgtggaagattgaggtccatgaccagaaagaacgt
gtgtatgagatgcgacgatggaacgaggccttagtcaccaacatgttgcccgagcatgtt
gcacgccatttcctggggtccaagaagagagatgaggagctgtacagccagtcttacgat
gagattggagtcatgttcgcttccctgcccaactttgctgacttctacactgaggagagc
atcaataatggtggcattgagtgtctacgcttcctcaatgagatcatctctgacttcgac
tctctcttagataatcccaaattccgggtcatcaccaagatcaaaaccattggcagcacc
tacatggcagcttcaggagtcaccccagatgtcaacaccaatggctttaccagctccagc
aaggaggagaagtcggataaggaacgctggcagcacctggctgacctggcggactttgca
ctagccatgaaggatacacttacaaacatcaacaaccagtcattcaacaacttcatgttg
cgcataggcatgaacaaaggaggagttcttgctggagtcattggagcccggaaaccacac
tatgacatctggggcaacacagtcaacgtggccagcaggatggagtccacaggggtcatg
ggtaacatccaggtggtagaagaaacgcaagtcatcctccgagaatatggcttccgcttt
gtacgacgaggccccatctttgtgaaagggaaaggggagcttctgacctttttcttgaag
ggccgggataggccggctgccttccctaatggctcctctgttacactgccccaccaagtg
gtggacaactcctga

DBGET integrated database retrieval system