KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103746495
Entry
103746495         CDS       T03372                                 

Gene name
Cdk2
Definition
(RefSeq) cyclin dependent kinase 2
  KO
K02206  cyclin-dependent kinase 2 [EC:2.7.11.22]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04068  FoxO signaling pathway
ngi04110  Cell cycle
ngi04114  Oocyte meiosis
ngi04115  p53 signaling pathway
ngi04151  PI3K-Akt signaling pathway
ngi04218  Cellular senescence
ngi04914  Progesterone-mediated oocyte maturation
ngi04934  Cushing syndrome
ngi05160  Hepatitis C
ngi05161  Hepatitis B
ngi05162  Measles
ngi05165  Human papillomavirus infection
ngi05166  Human T-cell leukemia virus 1 infection
ngi05169  Epstein-Barr virus infection
ngi05200  Pathways in cancer
ngi05203  Viral carcinogenesis
ngi05215  Prostate cancer
ngi05222  Small cell lung cancer
ngi05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    103746495 (Cdk2)
   04151 PI3K-Akt signaling pathway
    103746495 (Cdk2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103746495 (Cdk2)
   04114 Oocyte meiosis
    103746495 (Cdk2)
   04115 p53 signaling pathway
    103746495 (Cdk2)
   04218 Cellular senescence
    103746495 (Cdk2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    103746495 (Cdk2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103746495 (Cdk2)
   05203 Viral carcinogenesis
    103746495 (Cdk2)
  09162 Cancer: specific types
   05226 Gastric cancer
    103746495 (Cdk2)
   05215 Prostate cancer
    103746495 (Cdk2)
   05222 Small cell lung cancer
    103746495 (Cdk2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103746495 (Cdk2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103746495 (Cdk2)
   05161 Hepatitis B
    103746495 (Cdk2)
   05160 Hepatitis C
    103746495 (Cdk2)
   05162 Measles
    103746495 (Cdk2)
   05169 Epstein-Barr virus infection
    103746495 (Cdk2)
   05165 Human papillomavirus infection
    103746495 (Cdk2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ngi01001]
    103746495 (Cdk2)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ngi03032]
    103746495 (Cdk2)
   03036 Chromosome and associated proteins [BR:ngi03036]
    103746495 (Cdk2)
Enzymes [BR:ngi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     103746495 (Cdk2)
Protein kinases [BR:ngi01001]
 Serine/threonine kinases: CMGC group
  CDK family
   103746495 (Cdk2)
DNA replication proteins [BR:ngi03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    103746495 (Cdk2)
Chromosome and associated proteins [BR:ngi03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    103746495 (Cdk2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Haspin_kinase Kinase-like
Other DBs
NCBI-GeneID: 103746495
NCBI-ProteinID: XP_008846909
LinkDB
Position
Un
AA seq 346 aa
MENFQKVEKIGEGTYGVVYKAKNKLTGEVVALKKIRLDTETEGVPSTAIREISLLKELNH
PNIVKLLDVIHTENKLYLVFEFLHQDLKKFMDASALTGIPLPLIKSYLFQLLQGLAFCHS
HRVLHRDLKPQNLLINAEGSIKLADFGLARAFGVPVRTYTHEVVTLWYRAPEILLGCKYY
STAVDIWSLGCIFAEMHLVCTQHHAKCCGEHRRNGRHSLCPLCSYLEVAASQGGGMTAVS
TPYPVTRRALFPGDSEIDQLFRIFRTLGTPDEVVWPGVTSMPDYKPSFPKWARQDFSKVV
PPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL
NT seq 1041 nt   +upstreamnt  +downstreamnt
atggagaacttccaaaaggtagaaaagatcggagagggcacgtacggagttgtgtacaag
gccaaaaacaagttgaccggagaagtagtggcgctaaagaaaatccggctagacactgag
actgaaggtgtacccagtactgccatccgagagatctctctgcttaaggagcttaatcac
ccaaacattgtcaagctgctggatgtcatccacacagaaaataagctgtacctggttttt
gaatttctgcaccaggatctcaagaaatttatggatgcttctgctctcacaggcatccct
cttcccctcatcaagagttatctgttccagctgctccagggcttagcattctgccattct
caccgtgtcctgcaccgagaccttaagccccagaatctgcttatcaatgcagaggggtct
atcaagctggcagacttcggactagccagagcctttggagtacctgttcgtacttatacc
catgaggtggtgaccctgtggtaccgagcacctgaaatccttctgggctgcaagtactat
tccacagccgtggatatctggagcctgggctgcatctttgctgaaatgcacctagtgtgt
acccagcaccatgctaagtgctgtggggaacacagaagaaatggaagacacagtctctgc
ccgctgtgctcctatctagaagtggctgcatcacaaggaggggggatgaccgcagtgtct
accccataccccgtgacccgccgggccttattccctggagattctgagattgaccaactc
ttccggatctttcggactctgggaaccccagatgaggtggtttggccaggagttacttct
atgcctgactataaaccgagtttccccaagtgggcccggcaagattttagcaaagttgtg
cctcccctggatgaagatggccggagcttgttatcgcaaatgctacattatgaccccaac
aagcggatttcagcaaaagcagctttggctcaccctttcttccaggatgtgaccaagcca
gtaccccaccttcgactttaa

DBGET integrated database retrieval system