KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103746884
Entry
103746884         CDS       T03372                                 

Gene name
Akt3
Definition
(RefSeq) AKT serine/threonine kinase 3
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi01521  EGFR tyrosine kinase inhibitor resistance
ngi01522  Endocrine resistance
ngi01524  Platinum drug resistance
ngi04010  MAPK signaling pathway
ngi04012  ErbB signaling pathway
ngi04014  Ras signaling pathway
ngi04015  Rap1 signaling pathway
ngi04022  cGMP-PKG signaling pathway
ngi04024  cAMP signaling pathway
ngi04062  Chemokine signaling pathway
ngi04066  HIF-1 signaling pathway
ngi04068  FoxO signaling pathway
ngi04071  Sphingolipid signaling pathway
ngi04072  Phospholipase D signaling pathway
ngi04140  Autophagy - animal
ngi04150  mTOR signaling pathway
ngi04151  PI3K-Akt signaling pathway
ngi04152  AMPK signaling pathway
ngi04210  Apoptosis
ngi04211  Longevity regulating pathway
ngi04213  Longevity regulating pathway - multiple species
ngi04218  Cellular senescence
ngi04261  Adrenergic signaling in cardiomyocytes
ngi04370  VEGF signaling pathway
ngi04371  Apelin signaling pathway
ngi04380  Osteoclast differentiation
ngi04510  Focal adhesion
ngi04550  Signaling pathways regulating pluripotency of stem cells
ngi04611  Platelet activation
ngi04613  Neutrophil extracellular trap formation
ngi04620  Toll-like receptor signaling pathway
ngi04625  C-type lectin receptor signaling pathway
ngi04630  JAK-STAT signaling pathway
ngi04660  T cell receptor signaling pathway
ngi04662  B cell receptor signaling pathway
ngi04664  Fc epsilon RI signaling pathway
ngi04666  Fc gamma R-mediated phagocytosis
ngi04668  TNF signaling pathway
ngi04722  Neurotrophin signaling pathway
ngi04725  Cholinergic synapse
ngi04728  Dopaminergic synapse
ngi04910  Insulin signaling pathway
ngi04914  Progesterone-mediated oocyte maturation
ngi04915  Estrogen signaling pathway
ngi04917  Prolactin signaling pathway
ngi04919  Thyroid hormone signaling pathway
ngi04920  Adipocytokine signaling pathway
ngi04922  Glucagon signaling pathway
ngi04923  Regulation of lipolysis in adipocytes
ngi04926  Relaxin signaling pathway
ngi04929  GnRH secretion
ngi04931  Insulin resistance
ngi04932  Non-alcoholic fatty liver disease
ngi04933  AGE-RAGE signaling pathway in diabetic complications
ngi04935  Growth hormone synthesis, secretion and action
ngi04973  Carbohydrate digestion and absorption
ngi05010  Alzheimer disease
ngi05017  Spinocerebellar ataxia
ngi05132  Salmonella infection
ngi05135  Yersinia infection
ngi05142  Chagas disease
ngi05145  Toxoplasmosis
ngi05152  Tuberculosis
ngi05160  Hepatitis C
ngi05161  Hepatitis B
ngi05162  Measles
ngi05163  Human cytomegalovirus infection
ngi05164  Influenza A
ngi05165  Human papillomavirus infection
ngi05166  Human T-cell leukemia virus 1 infection
ngi05167  Kaposi sarcoma-associated herpesvirus infection
ngi05168  Herpes simplex virus 1 infection
ngi05169  Epstein-Barr virus infection
ngi05170  Human immunodeficiency virus 1 infection
ngi05200  Pathways in cancer
ngi05205  Proteoglycans in cancer
ngi05210  Colorectal cancer
ngi05211  Renal cell carcinoma
ngi05212  Pancreatic cancer
ngi05213  Endometrial cancer
ngi05214  Glioma
ngi05215  Prostate cancer
ngi05218  Melanoma
ngi05220  Chronic myeloid leukemia
ngi05221  Acute myeloid leukemia
ngi05222  Small cell lung cancer
ngi05223  Non-small cell lung cancer
ngi05224  Breast cancer
ngi05225  Hepatocellular carcinoma
ngi05226  Gastric cancer
ngi05230  Central carbon metabolism in cancer
ngi05231  Choline metabolism in cancer
ngi05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ngi05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103746884 (Akt3)
   04012 ErbB signaling pathway
    103746884 (Akt3)
   04014 Ras signaling pathway
    103746884 (Akt3)
   04015 Rap1 signaling pathway
    103746884 (Akt3)
   04370 VEGF signaling pathway
    103746884 (Akt3)
   04371 Apelin signaling pathway
    103746884 (Akt3)
   04630 JAK-STAT signaling pathway
    103746884 (Akt3)
   04668 TNF signaling pathway
    103746884 (Akt3)
   04066 HIF-1 signaling pathway
    103746884 (Akt3)
   04068 FoxO signaling pathway
    103746884 (Akt3)
   04072 Phospholipase D signaling pathway
    103746884 (Akt3)
   04071 Sphingolipid signaling pathway
    103746884 (Akt3)
   04024 cAMP signaling pathway
    103746884 (Akt3)
   04022 cGMP-PKG signaling pathway
    103746884 (Akt3)
   04151 PI3K-Akt signaling pathway
    103746884 (Akt3)
   04152 AMPK signaling pathway
    103746884 (Akt3)
   04150 mTOR signaling pathway
    103746884 (Akt3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103746884 (Akt3)
  09143 Cell growth and death
   04210 Apoptosis
    103746884 (Akt3)
   04218 Cellular senescence
    103746884 (Akt3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103746884 (Akt3)
   04550 Signaling pathways regulating pluripotency of stem cells
    103746884 (Akt3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103746884 (Akt3)
   04613 Neutrophil extracellular trap formation
    103746884 (Akt3)
   04620 Toll-like receptor signaling pathway
    103746884 (Akt3)
   04625 C-type lectin receptor signaling pathway
    103746884 (Akt3)
   04660 T cell receptor signaling pathway
    103746884 (Akt3)
   04662 B cell receptor signaling pathway
    103746884 (Akt3)
   04664 Fc epsilon RI signaling pathway
    103746884 (Akt3)
   04666 Fc gamma R-mediated phagocytosis
    103746884 (Akt3)
   04062 Chemokine signaling pathway
    103746884 (Akt3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103746884 (Akt3)
   04922 Glucagon signaling pathway
    103746884 (Akt3)
   04923 Regulation of lipolysis in adipocytes
    103746884 (Akt3)
   04920 Adipocytokine signaling pathway
    103746884 (Akt3)
   04929 GnRH secretion
    103746884 (Akt3)
   04915 Estrogen signaling pathway
    103746884 (Akt3)
   04914 Progesterone-mediated oocyte maturation
    103746884 (Akt3)
   04917 Prolactin signaling pathway
    103746884 (Akt3)
   04926 Relaxin signaling pathway
    103746884 (Akt3)
   04935 Growth hormone synthesis, secretion and action
    103746884 (Akt3)
   04919 Thyroid hormone signaling pathway
    103746884 (Akt3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103746884 (Akt3)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    103746884 (Akt3)
  09156 Nervous system
   04725 Cholinergic synapse
    103746884 (Akt3)
   04728 Dopaminergic synapse
    103746884 (Akt3)
   04722 Neurotrophin signaling pathway
    103746884 (Akt3)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103746884 (Akt3)
  09149 Aging
   04211 Longevity regulating pathway
    103746884 (Akt3)
   04213 Longevity regulating pathway - multiple species
    103746884 (Akt3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103746884 (Akt3)
   05205 Proteoglycans in cancer
    103746884 (Akt3)
   05230 Central carbon metabolism in cancer
    103746884 (Akt3)
   05231 Choline metabolism in cancer
    103746884 (Akt3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103746884 (Akt3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103746884 (Akt3)
   05212 Pancreatic cancer
    103746884 (Akt3)
   05225 Hepatocellular carcinoma
    103746884 (Akt3)
   05226 Gastric cancer
    103746884 (Akt3)
   05214 Glioma
    103746884 (Akt3)
   05221 Acute myeloid leukemia
    103746884 (Akt3)
   05220 Chronic myeloid leukemia
    103746884 (Akt3)
   05218 Melanoma
    103746884 (Akt3)
   05211 Renal cell carcinoma
    103746884 (Akt3)
   05215 Prostate cancer
    103746884 (Akt3)
   05213 Endometrial cancer
    103746884 (Akt3)
   05224 Breast cancer
    103746884 (Akt3)
   05222 Small cell lung cancer
    103746884 (Akt3)
   05223 Non-small cell lung cancer
    103746884 (Akt3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103746884 (Akt3)
   05017 Spinocerebellar ataxia
    103746884 (Akt3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103746884 (Akt3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    103746884 (Akt3)
   04931 Insulin resistance
    103746884 (Akt3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    103746884 (Akt3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103746884 (Akt3)
   05135 Yersinia infection
    103746884 (Akt3)
   05152 Tuberculosis
    103746884 (Akt3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103746884 (Akt3)
   05170 Human immunodeficiency virus 1 infection
    103746884 (Akt3)
   05161 Hepatitis B
    103746884 (Akt3)
   05160 Hepatitis C
    103746884 (Akt3)
   05164 Influenza A
    103746884 (Akt3)
   05162 Measles
    103746884 (Akt3)
   05168 Herpes simplex virus 1 infection
    103746884 (Akt3)
   05163 Human cytomegalovirus infection
    103746884 (Akt3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103746884 (Akt3)
   05169 Epstein-Barr virus infection
    103746884 (Akt3)
   05165 Human papillomavirus infection
    103746884 (Akt3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103746884 (Akt3)
   05142 Chagas disease
    103746884 (Akt3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103746884 (Akt3)
   01524 Platinum drug resistance
    103746884 (Akt3)
   01522 Endocrine resistance
    103746884 (Akt3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ngi01001]
    103746884 (Akt3)
Enzymes [BR:ngi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     103746884 (Akt3)
Protein kinases [BR:ngi01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   103746884 (Akt3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C FTA2 PH_11
Other DBs
NCBI-GeneID: 103746884
NCBI-ProteinID: XP_008847383
LinkDB
Position
Un
AA seq 503 aa
MSDVTIVKEGWVQKRGEYIKNWRPRYFLLKTDGSFIGYKEKPQDVDLPYPLNNFSVAKCQ
LMKTERPKPNTFIIRCLQWTTVIERTFHVDTPEEREEWTEAIQAVADRLQRQEEERMNCS
PTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILK
KEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRE
RVFSEDRTRFYGAEIVSALDYLHSGKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDA
ATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILM
EDIKFPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFSGVNWQDVYDKKLVP
PFKPQVTSETDTRYFDEEFTAQTITITPPEKCSSLSNTAIEDKNPTPSSQRCLGGGVAVV
HKWKECIVLPESAHINLMVNTGY
NT seq 1512 nt   +upstreamnt  +downstreamnt
atgagcgatgtaaccattgtgaaagaaggttgggttcagaagaggggagaatatataaaa
aactggaggccaagatacttccttttgaagacagatggctcattcataggatataaagag
aaacctcaagatgtggatttaccatatcccctcaacaacttttcagtggcaaaatgccag
ttaatgaaaacagaacgaccaaagccaaacacatttatcatcagatgtctgcagtggacc
actgtcatagagagaacatttcatgtagatactccagaggaaagggaggaatggacagaa
gctatccaagctgtagcagacagattgcagaggcaagaggaagagaggatgaattgtagc
ccaacttcgcagattgataatataggagaggaagagatggatgcttctacaacccatcat
aaaagaaagacaatgaatgactttgactatttgaaactactaggtaaaggaacttttggg
aaagttattttggttcgagagaaggcaagtggtaaatattatgctatgaagattctgaag
aaagaagtcattattgcaaaggatgaagtggctcacactctaactgagagcagagtttta
aagaacactaggcatccgtttttaacatccttgaaatattccttccagacaaaagaccgt
ttgtgttttgtgatggaatatgttaatgggggagagctgtttttccatttgtcgagagag
cgggtgttctctgaggaccgcacacgtttctatggcgcagaaattgtctctgccttggac
tatctacattctggaaagattgtgtaccgtgatctcaagttggagaatttgatgctggat
aaggatggccatataaaaatcacagattttggactttgcaaagaagggatcacagatgca
gccaccatgaagacattctgtggcaccccagagtacctggcaccagaggtattggaagat
aatgactatggccgagcagtggactggtggggcctgggggttgtcatgtatgaaatgatg
tgtgggaggttgcctttctacaaccaggatcacgagaagctctttgaactaatactaatg
gaagacattaaatttcctcgaacactctcttcagatgcaaaatcattgctttcagggctc
ttgataaaggatccaaataaacgccttggtggaggaccagatgatgcaaaagaaatcatg
agacacagtttcttctctggagtaaactggcaagatgtgtatgataaaaagcttgtacct
ccttttaagcctcaagtaacatctgagacagacaccagatattttgatgaagaattcact
gctcagactattacaataacaccacctgaaaaatgctcctctctctcaaatactgctatt
gaagataaaaatccgacaccatcgagccaaagatgcctgggtgggggggtggctgttgtt
cacaaatggaaagaatgcatagtgcttcctgaatctgcacacattaatttgatggtaaat
actgggtattga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103750757
Entry
103750757         CDS       T03372                                 

Gene name
Akt2
Definition
(RefSeq) AKT serine/threonine kinase 2
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi01521  EGFR tyrosine kinase inhibitor resistance
ngi01522  Endocrine resistance
ngi01524  Platinum drug resistance
ngi04010  MAPK signaling pathway
ngi04012  ErbB signaling pathway
ngi04014  Ras signaling pathway
ngi04015  Rap1 signaling pathway
ngi04022  cGMP-PKG signaling pathway
ngi04024  cAMP signaling pathway
ngi04062  Chemokine signaling pathway
ngi04066  HIF-1 signaling pathway
ngi04068  FoxO signaling pathway
ngi04071  Sphingolipid signaling pathway
ngi04072  Phospholipase D signaling pathway
ngi04140  Autophagy - animal
ngi04150  mTOR signaling pathway
ngi04151  PI3K-Akt signaling pathway
ngi04152  AMPK signaling pathway
ngi04210  Apoptosis
ngi04211  Longevity regulating pathway
ngi04213  Longevity regulating pathway - multiple species
ngi04218  Cellular senescence
ngi04261  Adrenergic signaling in cardiomyocytes
ngi04370  VEGF signaling pathway
ngi04371  Apelin signaling pathway
ngi04380  Osteoclast differentiation
ngi04510  Focal adhesion
ngi04550  Signaling pathways regulating pluripotency of stem cells
ngi04611  Platelet activation
ngi04613  Neutrophil extracellular trap formation
ngi04620  Toll-like receptor signaling pathway
ngi04625  C-type lectin receptor signaling pathway
ngi04630  JAK-STAT signaling pathway
ngi04660  T cell receptor signaling pathway
ngi04662  B cell receptor signaling pathway
ngi04664  Fc epsilon RI signaling pathway
ngi04666  Fc gamma R-mediated phagocytosis
ngi04668  TNF signaling pathway
ngi04722  Neurotrophin signaling pathway
ngi04725  Cholinergic synapse
ngi04728  Dopaminergic synapse
ngi04910  Insulin signaling pathway
ngi04914  Progesterone-mediated oocyte maturation
ngi04915  Estrogen signaling pathway
ngi04917  Prolactin signaling pathway
ngi04919  Thyroid hormone signaling pathway
ngi04920  Adipocytokine signaling pathway
ngi04922  Glucagon signaling pathway
ngi04923  Regulation of lipolysis in adipocytes
ngi04926  Relaxin signaling pathway
ngi04929  GnRH secretion
ngi04931  Insulin resistance
ngi04932  Non-alcoholic fatty liver disease
ngi04933  AGE-RAGE signaling pathway in diabetic complications
ngi04935  Growth hormone synthesis, secretion and action
ngi04973  Carbohydrate digestion and absorption
ngi05010  Alzheimer disease
ngi05017  Spinocerebellar ataxia
ngi05132  Salmonella infection
ngi05135  Yersinia infection
ngi05142  Chagas disease
ngi05145  Toxoplasmosis
ngi05152  Tuberculosis
ngi05160  Hepatitis C
ngi05161  Hepatitis B
ngi05162  Measles
ngi05163  Human cytomegalovirus infection
ngi05164  Influenza A
ngi05165  Human papillomavirus infection
ngi05166  Human T-cell leukemia virus 1 infection
ngi05167  Kaposi sarcoma-associated herpesvirus infection
ngi05168  Herpes simplex virus 1 infection
ngi05169  Epstein-Barr virus infection
ngi05170  Human immunodeficiency virus 1 infection
ngi05200  Pathways in cancer
ngi05205  Proteoglycans in cancer
ngi05210  Colorectal cancer
ngi05211  Renal cell carcinoma
ngi05212  Pancreatic cancer
ngi05213  Endometrial cancer
ngi05214  Glioma
ngi05215  Prostate cancer
ngi05218  Melanoma
ngi05220  Chronic myeloid leukemia
ngi05221  Acute myeloid leukemia
ngi05222  Small cell lung cancer
ngi05223  Non-small cell lung cancer
ngi05224  Breast cancer
ngi05225  Hepatocellular carcinoma
ngi05226  Gastric cancer
ngi05230  Central carbon metabolism in cancer
ngi05231  Choline metabolism in cancer
ngi05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ngi05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103750757 (Akt2)
   04012 ErbB signaling pathway
    103750757 (Akt2)
   04014 Ras signaling pathway
    103750757 (Akt2)
   04015 Rap1 signaling pathway
    103750757 (Akt2)
   04370 VEGF signaling pathway
    103750757 (Akt2)
   04371 Apelin signaling pathway
    103750757 (Akt2)
   04630 JAK-STAT signaling pathway
    103750757 (Akt2)
   04668 TNF signaling pathway
    103750757 (Akt2)
   04066 HIF-1 signaling pathway
    103750757 (Akt2)
   04068 FoxO signaling pathway
    103750757 (Akt2)
   04072 Phospholipase D signaling pathway
    103750757 (Akt2)
   04071 Sphingolipid signaling pathway
    103750757 (Akt2)
   04024 cAMP signaling pathway
    103750757 (Akt2)
   04022 cGMP-PKG signaling pathway
    103750757 (Akt2)
   04151 PI3K-Akt signaling pathway
    103750757 (Akt2)
   04152 AMPK signaling pathway
    103750757 (Akt2)
   04150 mTOR signaling pathway
    103750757 (Akt2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103750757 (Akt2)
  09143 Cell growth and death
   04210 Apoptosis
    103750757 (Akt2)
   04218 Cellular senescence
    103750757 (Akt2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103750757 (Akt2)
   04550 Signaling pathways regulating pluripotency of stem cells
    103750757 (Akt2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103750757 (Akt2)
   04613 Neutrophil extracellular trap formation
    103750757 (Akt2)
   04620 Toll-like receptor signaling pathway
    103750757 (Akt2)
   04625 C-type lectin receptor signaling pathway
    103750757 (Akt2)
   04660 T cell receptor signaling pathway
    103750757 (Akt2)
   04662 B cell receptor signaling pathway
    103750757 (Akt2)
   04664 Fc epsilon RI signaling pathway
    103750757 (Akt2)
   04666 Fc gamma R-mediated phagocytosis
    103750757 (Akt2)
   04062 Chemokine signaling pathway
    103750757 (Akt2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103750757 (Akt2)
   04922 Glucagon signaling pathway
    103750757 (Akt2)
   04923 Regulation of lipolysis in adipocytes
    103750757 (Akt2)
   04920 Adipocytokine signaling pathway
    103750757 (Akt2)
   04929 GnRH secretion
    103750757 (Akt2)
   04915 Estrogen signaling pathway
    103750757 (Akt2)
   04914 Progesterone-mediated oocyte maturation
    103750757 (Akt2)
   04917 Prolactin signaling pathway
    103750757 (Akt2)
   04926 Relaxin signaling pathway
    103750757 (Akt2)
   04935 Growth hormone synthesis, secretion and action
    103750757 (Akt2)
   04919 Thyroid hormone signaling pathway
    103750757 (Akt2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103750757 (Akt2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    103750757 (Akt2)
  09156 Nervous system
   04725 Cholinergic synapse
    103750757 (Akt2)
   04728 Dopaminergic synapse
    103750757 (Akt2)
   04722 Neurotrophin signaling pathway
    103750757 (Akt2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103750757 (Akt2)
  09149 Aging
   04211 Longevity regulating pathway
    103750757 (Akt2)
   04213 Longevity regulating pathway - multiple species
    103750757 (Akt2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103750757 (Akt2)
   05205 Proteoglycans in cancer
    103750757 (Akt2)
   05230 Central carbon metabolism in cancer
    103750757 (Akt2)
   05231 Choline metabolism in cancer
    103750757 (Akt2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103750757 (Akt2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103750757 (Akt2)
   05212 Pancreatic cancer
    103750757 (Akt2)
   05225 Hepatocellular carcinoma
    103750757 (Akt2)
   05226 Gastric cancer
    103750757 (Akt2)
   05214 Glioma
    103750757 (Akt2)
   05221 Acute myeloid leukemia
    103750757 (Akt2)
   05220 Chronic myeloid leukemia
    103750757 (Akt2)
   05218 Melanoma
    103750757 (Akt2)
   05211 Renal cell carcinoma
    103750757 (Akt2)
   05215 Prostate cancer
    103750757 (Akt2)
   05213 Endometrial cancer
    103750757 (Akt2)
   05224 Breast cancer
    103750757 (Akt2)
   05222 Small cell lung cancer
    103750757 (Akt2)
   05223 Non-small cell lung cancer
    103750757 (Akt2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103750757 (Akt2)
   05017 Spinocerebellar ataxia
    103750757 (Akt2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103750757 (Akt2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    103750757 (Akt2)
   04931 Insulin resistance
    103750757 (Akt2)
   04933 AGE-RAGE signaling pathway in diabetic complications
    103750757 (Akt2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103750757 (Akt2)
   05135 Yersinia infection
    103750757 (Akt2)
   05152 Tuberculosis
    103750757 (Akt2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103750757 (Akt2)
   05170 Human immunodeficiency virus 1 infection
    103750757 (Akt2)
   05161 Hepatitis B
    103750757 (Akt2)
   05160 Hepatitis C
    103750757 (Akt2)
   05164 Influenza A
    103750757 (Akt2)
   05162 Measles
    103750757 (Akt2)
   05168 Herpes simplex virus 1 infection
    103750757 (Akt2)
   05163 Human cytomegalovirus infection
    103750757 (Akt2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103750757 (Akt2)
   05169 Epstein-Barr virus infection
    103750757 (Akt2)
   05165 Human papillomavirus infection
    103750757 (Akt2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103750757 (Akt2)
   05142 Chagas disease
    103750757 (Akt2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103750757 (Akt2)
   01524 Platinum drug resistance
    103750757 (Akt2)
   01522 Endocrine resistance
    103750757 (Akt2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ngi01001]
    103750757 (Akt2)
Enzymes [BR:ngi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     103750757 (Akt2)
Protein kinases [BR:ngi01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   103750757 (Akt2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C
Other DBs
NCBI-GeneID: 103750757
NCBI-ProteinID: XP_008852209
LinkDB
Position
Un
AA seq 481 aa
MNEVSVIKEGWLHKRGEYIKTWRPRYFLLKSDGSFIGYKERPEAPDQTLPPLNNFSVAEC
QLMKTERPRPNTFVIRCLQWTTVIERTFHVDSPDEREEWMRAIQMVANSLKQRGPGEDPM
DYKCGSPSDSSASEEMEVAVSKARAKVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAM
KILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFH
LSRERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEG
ISDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFE
LILMEEIRFPRTLGPEAKSLLAGLLKKDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQK
KLLPPFKPQVTSEVDTRYFDDEFTAQSITITPPDRYDSLGSLDLDHRTHFPQFSYSASIR
E
NT seq 1446 nt   +upstreamnt  +downstreamnt
atgaatgaggtgtctgtcatcaaagaaggctggctccacaagcgcggagaatacatcaag
acctggaggccccggtacttccttctgaagagtgacggctctttcattgggtataaggag
aggcccgaggcccctgaccagaccttaccccccctaaacaacttctctgtagcagaatgc
cagctgatgaagacagagaggccacggcccaacacatttgtcatacgctgcctacagtgg
accacggtcattgagaggaccttccatgtagattctccagatgagagggaggagtggatg
cgggctattcagatggtcgccaacagcttgaagcagcgaggcccaggtgaggatcccatg
gactacaagtgtggctcccccagtgactcttctgcatctgaggagatggaggtagctgtc
agcaaggcacgggccaaagtgaccatgaacgactttgattatctcaagctcctcggcaag
ggcacctttggcaaagtcatcctagtgcgggagaaggccactggtcgctattatgccatg
aagatcttgcggaaggaggtcatcattgccaaggatgaagttgcccacacagtcactgag
agccgggttctgcagaacaccaggcaccccttcctcactgccctgaagtatgccttccag
acccacgaccgcctgtgctttgtgatggagtatgccaatgggggtgagttgttcttccac
ctctctcgggagcgagtcttcacggaggagcgagcacgcttttatggtgcagagatagtt
tcggctcttgagtatttgcactcaagagatgtggtgtaccgggacatcaagctggagaac
cttatgctggacaaagatggccacatcaagatcactgacttcggcctgtgcaaagagggc
atcagtgacggggccaccatgaaaaccttctgtgggacgccggagtacctggcgcccgag
gtgctggaggacaacgactacgggcgtgcggtggactggtgggggctgggtgtggtgatg
tacgagatgatgtgcggccgcctgcccttctacaaccaggatcacgagcgcctcttcgag
ctcatcctcatggaggagatacgcttccctcgcacacttgggcctgaggccaagtccttg
ctggctgggctgctgaagaaggacccgaagcagaggctcggcgggggccccagtgatgcc
aaggaggtcatggagcacaggttcttcctcagcatcaactggcaggacgtggtacagaag
aagctcttgccacccttcaaacctcaggtcacttccgaggtggacacaaggtacttcgat
gatgagttcaccgcccagtctatcacaatcacacccccagatcgctatgacagcctgggc
tcgctggatctggaccaccggacgcacttcccccagttctcctactcggccagcatccgc
gagtga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103752536
Entry
103752536         CDS       T03372                                 

Gene name
Akt1
Definition
(RefSeq) AKT serine/threonine kinase 1
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi01521  EGFR tyrosine kinase inhibitor resistance
ngi01522  Endocrine resistance
ngi01524  Platinum drug resistance
ngi04010  MAPK signaling pathway
ngi04012  ErbB signaling pathway
ngi04014  Ras signaling pathway
ngi04015  Rap1 signaling pathway
ngi04022  cGMP-PKG signaling pathway
ngi04024  cAMP signaling pathway
ngi04062  Chemokine signaling pathway
ngi04066  HIF-1 signaling pathway
ngi04068  FoxO signaling pathway
ngi04071  Sphingolipid signaling pathway
ngi04072  Phospholipase D signaling pathway
ngi04140  Autophagy - animal
ngi04150  mTOR signaling pathway
ngi04151  PI3K-Akt signaling pathway
ngi04152  AMPK signaling pathway
ngi04210  Apoptosis
ngi04211  Longevity regulating pathway
ngi04213  Longevity regulating pathway - multiple species
ngi04218  Cellular senescence
ngi04261  Adrenergic signaling in cardiomyocytes
ngi04370  VEGF signaling pathway
ngi04371  Apelin signaling pathway
ngi04380  Osteoclast differentiation
ngi04510  Focal adhesion
ngi04550  Signaling pathways regulating pluripotency of stem cells
ngi04611  Platelet activation
ngi04613  Neutrophil extracellular trap formation
ngi04620  Toll-like receptor signaling pathway
ngi04625  C-type lectin receptor signaling pathway
ngi04630  JAK-STAT signaling pathway
ngi04660  T cell receptor signaling pathway
ngi04662  B cell receptor signaling pathway
ngi04664  Fc epsilon RI signaling pathway
ngi04666  Fc gamma R-mediated phagocytosis
ngi04668  TNF signaling pathway
ngi04722  Neurotrophin signaling pathway
ngi04725  Cholinergic synapse
ngi04728  Dopaminergic synapse
ngi04910  Insulin signaling pathway
ngi04914  Progesterone-mediated oocyte maturation
ngi04915  Estrogen signaling pathway
ngi04917  Prolactin signaling pathway
ngi04919  Thyroid hormone signaling pathway
ngi04920  Adipocytokine signaling pathway
ngi04922  Glucagon signaling pathway
ngi04923  Regulation of lipolysis in adipocytes
ngi04926  Relaxin signaling pathway
ngi04929  GnRH secretion
ngi04931  Insulin resistance
ngi04932  Non-alcoholic fatty liver disease
ngi04933  AGE-RAGE signaling pathway in diabetic complications
ngi04935  Growth hormone synthesis, secretion and action
ngi04973  Carbohydrate digestion and absorption
ngi05010  Alzheimer disease
ngi05017  Spinocerebellar ataxia
ngi05132  Salmonella infection
ngi05135  Yersinia infection
ngi05142  Chagas disease
ngi05145  Toxoplasmosis
ngi05152  Tuberculosis
ngi05160  Hepatitis C
ngi05161  Hepatitis B
ngi05162  Measles
ngi05163  Human cytomegalovirus infection
ngi05164  Influenza A
ngi05165  Human papillomavirus infection
ngi05166  Human T-cell leukemia virus 1 infection
ngi05167  Kaposi sarcoma-associated herpesvirus infection
ngi05168  Herpes simplex virus 1 infection
ngi05169  Epstein-Barr virus infection
ngi05170  Human immunodeficiency virus 1 infection
ngi05200  Pathways in cancer
ngi05205  Proteoglycans in cancer
ngi05210  Colorectal cancer
ngi05211  Renal cell carcinoma
ngi05212  Pancreatic cancer
ngi05213  Endometrial cancer
ngi05214  Glioma
ngi05215  Prostate cancer
ngi05218  Melanoma
ngi05220  Chronic myeloid leukemia
ngi05221  Acute myeloid leukemia
ngi05222  Small cell lung cancer
ngi05223  Non-small cell lung cancer
ngi05224  Breast cancer
ngi05225  Hepatocellular carcinoma
ngi05226  Gastric cancer
ngi05230  Central carbon metabolism in cancer
ngi05231  Choline metabolism in cancer
ngi05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ngi05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103752536 (Akt1)
   04012 ErbB signaling pathway
    103752536 (Akt1)
   04014 Ras signaling pathway
    103752536 (Akt1)
   04015 Rap1 signaling pathway
    103752536 (Akt1)
   04370 VEGF signaling pathway
    103752536 (Akt1)
   04371 Apelin signaling pathway
    103752536 (Akt1)
   04630 JAK-STAT signaling pathway
    103752536 (Akt1)
   04668 TNF signaling pathway
    103752536 (Akt1)
   04066 HIF-1 signaling pathway
    103752536 (Akt1)
   04068 FoxO signaling pathway
    103752536 (Akt1)
   04072 Phospholipase D signaling pathway
    103752536 (Akt1)
   04071 Sphingolipid signaling pathway
    103752536 (Akt1)
   04024 cAMP signaling pathway
    103752536 (Akt1)
   04022 cGMP-PKG signaling pathway
    103752536 (Akt1)
   04151 PI3K-Akt signaling pathway
    103752536 (Akt1)
   04152 AMPK signaling pathway
    103752536 (Akt1)
   04150 mTOR signaling pathway
    103752536 (Akt1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103752536 (Akt1)
  09143 Cell growth and death
   04210 Apoptosis
    103752536 (Akt1)
   04218 Cellular senescence
    103752536 (Akt1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103752536 (Akt1)
   04550 Signaling pathways regulating pluripotency of stem cells
    103752536 (Akt1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103752536 (Akt1)
   04613 Neutrophil extracellular trap formation
    103752536 (Akt1)
   04620 Toll-like receptor signaling pathway
    103752536 (Akt1)
   04625 C-type lectin receptor signaling pathway
    103752536 (Akt1)
   04660 T cell receptor signaling pathway
    103752536 (Akt1)
   04662 B cell receptor signaling pathway
    103752536 (Akt1)
   04664 Fc epsilon RI signaling pathway
    103752536 (Akt1)
   04666 Fc gamma R-mediated phagocytosis
    103752536 (Akt1)
   04062 Chemokine signaling pathway
    103752536 (Akt1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103752536 (Akt1)
   04922 Glucagon signaling pathway
    103752536 (Akt1)
   04923 Regulation of lipolysis in adipocytes
    103752536 (Akt1)
   04920 Adipocytokine signaling pathway
    103752536 (Akt1)
   04929 GnRH secretion
    103752536 (Akt1)
   04915 Estrogen signaling pathway
    103752536 (Akt1)
   04914 Progesterone-mediated oocyte maturation
    103752536 (Akt1)
   04917 Prolactin signaling pathway
    103752536 (Akt1)
   04926 Relaxin signaling pathway
    103752536 (Akt1)
   04935 Growth hormone synthesis, secretion and action
    103752536 (Akt1)
   04919 Thyroid hormone signaling pathway
    103752536 (Akt1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103752536 (Akt1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    103752536 (Akt1)
  09156 Nervous system
   04725 Cholinergic synapse
    103752536 (Akt1)
   04728 Dopaminergic synapse
    103752536 (Akt1)
   04722 Neurotrophin signaling pathway
    103752536 (Akt1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103752536 (Akt1)
  09149 Aging
   04211 Longevity regulating pathway
    103752536 (Akt1)
   04213 Longevity regulating pathway - multiple species
    103752536 (Akt1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103752536 (Akt1)
   05205 Proteoglycans in cancer
    103752536 (Akt1)
   05230 Central carbon metabolism in cancer
    103752536 (Akt1)
   05231 Choline metabolism in cancer
    103752536 (Akt1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103752536 (Akt1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103752536 (Akt1)
   05212 Pancreatic cancer
    103752536 (Akt1)
   05225 Hepatocellular carcinoma
    103752536 (Akt1)
   05226 Gastric cancer
    103752536 (Akt1)
   05214 Glioma
    103752536 (Akt1)
   05221 Acute myeloid leukemia
    103752536 (Akt1)
   05220 Chronic myeloid leukemia
    103752536 (Akt1)
   05218 Melanoma
    103752536 (Akt1)
   05211 Renal cell carcinoma
    103752536 (Akt1)
   05215 Prostate cancer
    103752536 (Akt1)
   05213 Endometrial cancer
    103752536 (Akt1)
   05224 Breast cancer
    103752536 (Akt1)
   05222 Small cell lung cancer
    103752536 (Akt1)
   05223 Non-small cell lung cancer
    103752536 (Akt1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103752536 (Akt1)
   05017 Spinocerebellar ataxia
    103752536 (Akt1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103752536 (Akt1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    103752536 (Akt1)
   04931 Insulin resistance
    103752536 (Akt1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    103752536 (Akt1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103752536 (Akt1)
   05135 Yersinia infection
    103752536 (Akt1)
   05152 Tuberculosis
    103752536 (Akt1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103752536 (Akt1)
   05170 Human immunodeficiency virus 1 infection
    103752536 (Akt1)
   05161 Hepatitis B
    103752536 (Akt1)
   05160 Hepatitis C
    103752536 (Akt1)
   05164 Influenza A
    103752536 (Akt1)
   05162 Measles
    103752536 (Akt1)
   05168 Herpes simplex virus 1 infection
    103752536 (Akt1)
   05163 Human cytomegalovirus infection
    103752536 (Akt1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103752536 (Akt1)
   05169 Epstein-Barr virus infection
    103752536 (Akt1)
   05165 Human papillomavirus infection
    103752536 (Akt1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103752536 (Akt1)
   05142 Chagas disease
    103752536 (Akt1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103752536 (Akt1)
   01524 Platinum drug resistance
    103752536 (Akt1)
   01522 Endocrine resistance
    103752536 (Akt1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ngi01001]
    103752536 (Akt1)
Enzymes [BR:ngi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     103752536 (Akt1)
Protein kinases [BR:ngi01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   103752536 (Akt1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like PH_11 Pkinase_fungal Seadorna_VP7
Other DBs
NCBI-GeneID: 103752536
NCBI-ProteinID: XP_008854582
LinkDB
Position
Un
AA seq 481 aa
MDDAVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVEQRETPLNNFSVAQ
CQLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQTVADGLKRQEEETMD
FRSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMK
ILKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHL
SRERVFSEDRARFYGAEIVSALHYLHAEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEG
IKDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFE
LILMEEIRFPRTLGPEAKSLLSGLLKKDPTQRLGGGSEDAKEIMQHRFFASIVWQDVYEK
KLSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDNMECVDSERRPHFPQFSYSASGT
A
NT seq 1446 nt   +upstreamnt  +downstreamnt
atggacgacgccgtagccattgtgaaggagggctggctgcacaaacgaggggaatacatc
aagacctggcggcctcgctacttcctcctcaagaacgatggtacctttattggctacaag
gagcggcctcaggatgtggagcagcgtgagacccccctcaacaacttctcagtggcacaa
tgtcagctgatgaagacagagcggccgaggcccaacaccttcatcatccgttgcctgcag
tggaccacggtcatcgagcgtaccttccatgtggagacgcctgaggaacgggaggagtgg
accactgccatccagactgtggctgatggactcaagaggcaggaggaagagacgatggac
ttccgatcaggttcccccagtgacaattcgggggctgaagagatggaggtgtctctggct
aagcccaagcaccgtgtgaccatgaatgagtttgagtacctgaagctgctgggcaagggc
acctttgggaaggtgatcctggtgaaggagaaggccacaggccgttactatgccatgaag
atcctcaagaaggaggtcatcgttgccaaggatgaggtggcccacacactcaccgagaac
cgtgtcctgcaaaactctaggcatcccttcctcacggccctgaagtactcattccagacc
cacgaccgcctctgctttgtcatggaatatgccaacgggggtgagcttttcttccatctg
tcccgtgagcgcgtgttttctgaggaccgggcccgcttctacggtgcggagattgtgtcg
gccctgcactacttgcacgcggagaagaatgtggtgtaccgcgacctcaagctggagaac
ctcatgctggacaaggacggacacatcaagatcacagacttcgggctgtgcaaggagggt
atcaaggatggcgccaccatgaagaccttctgtgggacgcctgagtacctggcccctgag
gtgctggaggacaatgactacggccgagcagtggactggtgggggctgggcgtggtcatg
tacgagatgatgtgtggccgcctccccttctacaaccaggaccacgagaagctgtttgag
ctcatcctcatggaggagatccgcttcccacgcacactcggccccgaggccaagtccctg
ctttcggggctgcttaagaaggaccccacacagaggcttggcgggggctctgaggatgcc
aaggagatcatgcagcatcgcttctttgccagtatcgtgtggcaagatgtgtatgagaag
aagctgagcccacccttcaagccccaggtcacctctgagactgacaccaggtattttgac
gaagagttcacagcccagatgatcactatcacaccgcctgaccaagatgacaacatggag
tgtgtggatagtgagcggaggccgcacttccctcagttttcctactcggccagtggcaca
gcctga

DBGET integrated database retrieval system