KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103746886Help
Entry
103746886         CDS       T03372                                 

Gene name
Sord
Definition
(RefSeq) sorbitol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi00040  Pentose and glucuronate interconversions
ngi00051  Fructose and mannose metabolism
ngi01100  Metabolic pathways
Module
ngi_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    103746886 (Sord)
   00051 Fructose and mannose metabolism
    103746886 (Sord)
Enzymes [BR:ngi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     103746886 (Sord)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 Methyltransf_25 UDPG_MGDP_dh_N Methyltransf_16
Motif
Other DBs
NCBI-GeneID: 103746886
NCBI-ProteinID: XP_008847392
LinkDB All DBs
Position
Un
AA seq 357 aa AA seqDB search
MAAPAKLENLSLVVHGPGDLRLENYPVPEPGPNEVLLKMHSVGICGSDVHYWQHGRIGDF
VVKKPMVLGHEASGTVVKIGNLVKHLKPGDRVAIEPGAPRETDEFCKIGRYNLSPSIFFC
ATPPDDGNLCRFYKHSADFCYKLPDSVTFEEGALIEPLSVGIHACRRGGVSLGNKVLVCG
AGPVGIVTLLVAKAMGAAQVVVTDLSSSRLTKAKEVGADFVLQITKESPPEIASKVENLL
GSKPDVTIECTGAEPSIQTGIYVTRSGGTLVIVGMGSEMATIPLMHAAVREVDIKGVFRY
CNTWPMAISMLASKSLNVKPLVTHRFPLEKAVEAFETSKKGLGLKVMIKCDPNDQNP
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggcggccccagctaagctggagaacctgtccctggtggtgcacggacccggggacctt
cgcctggaaaactacccagttcctgaaccaggcccgaatgaggtgctgctgaagatgcac
tctgttgggatctgtggctcagatgttcactactggcagcatggtcgaattggagatttt
gttgtgaaaaagccaatggtgcttggccatgaagcttcaggaacagttgtaaaaatagga
aacctggtgaagcatctaaaaccaggggaccgtgttgccattgagcctggtgccccccga
gaaacagatgaattctgcaagattggtcgatacaatctgtcgccatctatcttcttctgt
gccacaccacctgatgatgggaatctctgccggttctataagcacagtgctgacttctgc
tacaagcttcctgacagtgtcacctttgaggaaggggccctgattgagccactgtctgtg
gggatccatgcttgccgacgaggtggagtctctctggggaacaaggtcttagtgtgcgga
gctgggccagttggtattgtcactttgcttgtggccaaggcaatgggagcagctcaagta
gtggtgactgatttgtcgtcttctcggttgaccaaagccaaggaagtcggggctgatttt
gtcctccaaattaccaaggagagccctccagaaatcgctagtaaagtggaaaatctgctg
ggaagcaagccggatgtcaccattgaatgcacaggagccgaaccctccatccagacgggc
atctatgtcactcgctctggtgggaccctggtgattgtggggatggggtccgagatggcc
accatacccctaatgcacgcagctgtccgagaggtggatatcaagggtgtgtttcgctac
tgcaacacgtggccaatggcgatttccatgcttgcctccaagtctttgaatgtgaaaccc
ttagtcacccataggtttcctctggagaaggctgtggaggcctttgaaacatccaaaaag
ggactggggttgaaagtcatgatcaaatgcgaccccaatgaccagaatccttaa

DBGET integrated database retrieval system