KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103746951
Entry
103746951         CDS       T03372                                 

Gene name
Il2
Definition
(RefSeq) interleukin 2
  KO
K05429  interleukin 2
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04061  Viral protein interaction with cytokine and cytokine receptor
ngi04151  PI3K-Akt signaling pathway
ngi04625  C-type lectin receptor signaling pathway
ngi04630  Jak-STAT signaling pathway
ngi04658  Th1 and Th2 cell differentiation
ngi04659  Th17 cell differentiation
ngi04660  T cell receptor signaling pathway
ngi04672  Intestinal immune network for IgA production
ngi04940  Type I diabetes mellitus
ngi05135  Yersinia infection
ngi05142  Chagas disease (American trypanosomiasis)
ngi05162  Measles
ngi05166  Human T-cell leukemia virus 1 infection
ngi05200  Pathways in cancer
ngi05320  Autoimmune thyroid disease
ngi05321  Inflammatory bowel disease (IBD)
ngi05330  Allograft rejection
ngi05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    103746951 (Il2)
   04151 PI3K-Akt signaling pathway
    103746951 (Il2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103746951 (Il2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    103746951 (Il2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    103746951 (Il2)
   04660 T cell receptor signaling pathway
    103746951 (Il2)
   04658 Th1 and Th2 cell differentiation
    103746951 (Il2)
   04659 Th17 cell differentiation
    103746951 (Il2)
   04672 Intestinal immune network for IgA production
    103746951 (Il2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103746951 (Il2)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    103746951 (Il2)
   05321 Inflammatory bowel disease (IBD)
    103746951 (Il2)
   05330 Allograft rejection
    103746951 (Il2)
   05332 Graft-versus-host disease
    103746951 (Il2)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    103746951 (Il2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    103746951 (Il2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103746951 (Il2)
   05162 Measles
    103746951 (Il2)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    103746951 (Il2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103746951 (Il2)
   00536 Glycosaminoglycan binding proteins [BR:ngi00536]
    103746951 (Il2)
Cytokines and growth factors [BR:ngi04052]
 Cytokines
  Interleukins
   103746951 (Il2)
Glycosaminoglycan binding proteins [BR:ngi00536]
 Heparan sulfate / Haparin
  Cytokines
   103746951 (Il2)
SSDB
Motif
Pfam: IL2 Desmo_N
Other DBs
NCBI-GeneID: 103746951
NCBI-ProteinID: XP_008847454
LinkDB
Position
Un
AA seq 154 aa
MYNMQLVSCVALTLALLVSSAPTSSPTKETQQQLQQLLLDLQMLLRGTTNHKNSELSRML
TFKFYMPKKATELTHLQCLEEELQPLQEVLSLAQSKSFHLKDTREFISNIKVTILKLKGS
ENTFMCDYDDETATVVEFLSRWITFCQSLISTLT
NT seq 465 nt   +upstreamnt  +downstreamnt
atgtacaacatgcagcttgtgtcttgtgttgctctgactctcgcactccttgtcagcagt
gctcctacttcaagccctacaaaggaaacacaacagcagctgcagcaattactgctggac
ttacagatgcttttgagaggcaccactaatcacaagaattctgaactctccaggatgctc
acatttaaattttacatgcccaagaaggccacagaattgacacatcttcagtgcctggaa
gaagaactacagcctctgcaggaagtcctgagcttggctcagagcaaaagctttcacttg
aaagacaccagggagttcatcagcaacatcaaagtaaccattctgaaactaaagggctct
gaaaacacattcatgtgtgactatgatgatgagacagcgactgttgtggaatttctgagc
agatggatcaccttctgtcaaagcctcatttcaacattgacatga

DBGET integrated database retrieval system