KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103747047
Entry
103747047         CDS       T03372                                 

Gene name
Il4
Definition
(RefSeq) interleukin 4
  KO
K05430  interleukin 4
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04151  PI3K-Akt signaling pathway
ngi04630  JAK-STAT signaling pathway
ngi04640  Hematopoietic cell lineage
ngi04657  IL-17 signaling pathway
ngi04658  Th1 and Th2 cell differentiation
ngi04659  Th17 cell differentiation
ngi04660  T cell receptor signaling pathway
ngi04664  Fc epsilon RI signaling pathway
ngi04672  Intestinal immune network for IgA production
ngi05140  Leishmaniasis
ngi05200  Pathways in cancer
ngi05310  Asthma
ngi05320  Autoimmune thyroid disease
ngi05321  Inflammatory bowel disease
ngi05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103747047 (Il4)
   04151 PI3K-Akt signaling pathway
    103747047 (Il4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103747047 (Il4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    103747047 (Il4)
   04660 T cell receptor signaling pathway
    103747047 (Il4)
   04658 Th1 and Th2 cell differentiation
    103747047 (Il4)
   04659 Th17 cell differentiation
    103747047 (Il4)
   04657 IL-17 signaling pathway
    103747047 (Il4)
   04664 Fc epsilon RI signaling pathway
    103747047 (Il4)
   04672 Intestinal immune network for IgA production
    103747047 (Il4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103747047 (Il4)
  09163 Immune disease
   05310 Asthma
    103747047 (Il4)
   05320 Autoimmune thyroid disease
    103747047 (Il4)
   05321 Inflammatory bowel disease
    103747047 (Il4)
   05330 Allograft rejection
    103747047 (Il4)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    103747047 (Il4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103747047 (Il4)
   00536 Glycosaminoglycan binding proteins [BR:ngi00536]
    103747047 (Il4)
Cytokines and growth factors [BR:ngi04052]
 Cytokines
  Interleukins
   103747047 (Il4)
Glycosaminoglycan binding proteins [BR:ngi00536]
 Heparan sulfate / Haparin
  Cytokines
   103747047 (Il4)
SSDB
Motif
Pfam: IL4
Other DBs
NCBI-GeneID: 103747047
NCBI-ProteinID: XP_008847572
LinkDB
Position
Un
AA seq 147 aa
MGLTPQLAATLLCLLVCAGNFAHGCNSENLAEIIHILNRLTSKGTPCTEMLVPDVFTETK
NTTEEKILCRTQKVLRKFYNSHIPCLKNNTLVLKDLQKVYRIVCSMSQLRNCTVSESTQI
TLKTFLESLKRMMQKKYNSAEAECLNL
NT seq 444 nt   +upstreamnt  +downstreamnt
atgggtctcaccccccagctggctgccacactcctctgcctcctagtatgtgctggcaac
tttgcccatggatgcaacagcgaaaacttagcagagatcatccatattttgaaccggctc
acaagcaaagggactccttgcaccgagatgcttgtgccagatgtctttacagaaaccaag
aacaccactgaggagaagatcctctgcaggacgcagaaggtgctccggaagttctataac
tcacatattccgtgcttgaaaaacaacaccttggttctcaaagacttgcaaaaagtctac
aggattgtctgcagcatgtcccagctgcgcaactgcaccgtgagtgaatccacacagata
acactgaaaaccttcttggaaagcctgaaaaggatgatgcaaaagaaatataacagtgca
gaagctgaatgtcttaatttatga

DBGET integrated database retrieval system