KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103747127
Entry
103747127         CDS       T03372                                 

Gene name
Ctnnb1
Definition
(RefSeq) catenin beta 1
  KO
K02105  catenin beta 1
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04015  Rap1 signaling pathway
ngi04310  Wnt signaling pathway
ngi04390  Hippo signaling pathway
ngi04510  Focal adhesion
ngi04520  Adherens junction
ngi04550  Signaling pathways regulating pluripotency of stem cells
ngi04670  Leukocyte transendothelial migration
ngi04916  Melanogenesis
ngi04919  Thyroid hormone signaling pathway
ngi04934  Cushing syndrome
ngi05010  Alzheimer disease
ngi05022  Pathways of neurodegeneration - multiple diseases
ngi05100  Bacterial invasion of epithelial cells
ngi05132  Salmonella infection
ngi05160  Hepatitis C
ngi05163  Human cytomegalovirus infection
ngi05165  Human papillomavirus infection
ngi05167  Kaposi sarcoma-associated herpesvirus infection
ngi05200  Pathways in cancer
ngi05205  Proteoglycans in cancer
ngi05210  Colorectal cancer
ngi05213  Endometrial cancer
ngi05215  Prostate cancer
ngi05216  Thyroid cancer
ngi05217  Basal cell carcinoma
ngi05224  Breast cancer
ngi05225  Hepatocellular carcinoma
ngi05226  Gastric cancer
ngi05412  Arrhythmogenic right ventricular cardiomyopathy
ngi05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    103747127 (Ctnnb1)
   04310 Wnt signaling pathway
    103747127 (Ctnnb1)
   04390 Hippo signaling pathway
    103747127 (Ctnnb1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103747127 (Ctnnb1)
   04520 Adherens junction
    103747127 (Ctnnb1)
   04550 Signaling pathways regulating pluripotency of stem cells
    103747127 (Ctnnb1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    103747127 (Ctnnb1)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    103747127 (Ctnnb1)
   04916 Melanogenesis
    103747127 (Ctnnb1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103747127 (Ctnnb1)
   05205 Proteoglycans in cancer
    103747127 (Ctnnb1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103747127 (Ctnnb1)
   05225 Hepatocellular carcinoma
    103747127 (Ctnnb1)
   05226 Gastric cancer
    103747127 (Ctnnb1)
   05216 Thyroid cancer
    103747127 (Ctnnb1)
   05217 Basal cell carcinoma
    103747127 (Ctnnb1)
   05215 Prostate cancer
    103747127 (Ctnnb1)
   05213 Endometrial cancer
    103747127 (Ctnnb1)
   05224 Breast cancer
    103747127 (Ctnnb1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103747127 (Ctnnb1)
   05022 Pathways of neurodegeneration - multiple diseases
    103747127 (Ctnnb1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103747127 (Ctnnb1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    103747127 (Ctnnb1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103747127 (Ctnnb1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103747127 (Ctnnb1)
   05100 Bacterial invasion of epithelial cells
    103747127 (Ctnnb1)
  09172 Infectious disease: viral
   05160 Hepatitis C
    103747127 (Ctnnb1)
   05163 Human cytomegalovirus infection
    103747127 (Ctnnb1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103747127 (Ctnnb1)
   05165 Human papillomavirus infection
    103747127 (Ctnnb1)
SSDB
Motif
Pfam: Arm Cnd1 Adaptin_N HEAT_2 HEAT_EZ KAP Atx10homo_assoc Arm_2 Queuosine_synth
Other DBs
NCBI-GeneID: 103747127
NCBI-ProteinID: XP_008847656
LinkDB
Position
Un
AA seq 781 aa
MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTS
QVLYEWEQGFSQSFTPEQAADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDSAHPT
NVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSK
KEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPAL
VKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDC
LQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEA
GGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCA
AGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEM
AQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLL
VRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFV
QLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLF
RMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFH
SGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTD
L
NT seq 2346 nt   +upstreamnt  +downstreamnt
atggctactcaagctgatttgatggagttggacatggcaatggagccagacagaaaagca
gctgtcagccactggcagcagcagtcttacctggactctgggatccattctggggccact
accacagccccttccctgagtggcaaaggcaatcctgaagaagaggatgtggacacctcc
caagtcctgtatgagtgggagcaaggattttcccagtccttcactccagaacaagcagct
gatattgacgggcagtatgccatgactcgagctcagagggtacgagctgccatgttccct
gagacattggatgagggcatgcaaattccatcaacgcagtttgactctgctcaccccact
aacgtccagcgtctggctgagccatcacagatgctgaaacatgccgtggtaaatttgatc
aactatcaggatgatgcagaacttgccacacgtgcaattcctgaactgacaaaactgcta
aatgatgaggaccaggtggtagtgaataaagctgcagttatggtccatcagctttctaaa
aaggaagcttccagacacgccatcatgcgctctcctcagatggtgtctgctattgtacgt
accatgcagaacaccaatgatgtagaaacagcacgttgtactgctggaactttgcacaac
ctctcccaccatcgcgagggcctgctggccatctttaagtctggaggcattcctgctctg
gtgaaaatgcttgggtccccagtggattccgtattgttttatgccattacaacgctccac
aaccttttattgcatcaagaaggagctaaaatggcagtgcgtttagccggtgggctacag
aaaatggttgctttgctcaacaaaacaaatgttaagttcttggctattacaacagactgc
cttcagattttagcttacggcaatcaagaaagcaagctgatcattctggctagtggtgga
ccccaagctttagtaaatataatgaggacctatacctacgagaagctactgtggaccaca
agtagagtactgaaggtgctctccgtctgctcaagtaataagccagctattgtagaagct
ggtgggatgcaggccttaggacttcaccttacagatccaagtcagcgtcttgttcagaac
tgtctctggactctcaggaatctttcagatgctgcaactaaacaggaagggatggaaggt
ctccttgggactctagttcagcttctaggttcagatgatatcaatgtggtcacctgcgca
gctggaatactctctaaccttacttgtaataactacaaaaacaagatgatggtgtgccag
gtagggggcatagaggctcttgtgcgcaccgtccttcgtgctggtgacagagaggatatc
actgagcctgccatctgtgctcttcgtcatctgaccagccggcatcaggaagctgagatg
gctcagaatgctgttcggcttcattatggactgcctgttgtggttaaactcctacaccct
ccctcccactggcctctaataaaggctactgttggattgattcgcaatcttgccctttgc
ccagcaaatcatgcacctttacgggagcagggtgcaattccccgcctagttcagttgctt
gttcgagcacatcaggacacccagcgtcgcacatccatgggtggaacacagcagcagttt
gtggagggggtccgcatggaagagattgttgaaggttgtaccggagctctccacatcctc
gctcgggatgttcacaaccggatcgtaatccgaggactaaataccattccactgtttgtg
cagctgctttattctcccattgaaaacatccagagagtagctgcaggggtcctctgtgaa
cttgctcaggacaaggaggctgcagaggccattgaagcagagggagccacagctcctctg
acggaactgctgcattctaggaatgaaggtgtggcaacatatgcagctgcagttttattc
cgaatgtctgaggacaagccacaggattacaagaaacggctttcggttgagctgaccagt
tccctcttcagaacagagccaatggcttggaatgagactgctgatcttggacttgacatt
ggtgcccagggagagcccctcggatatcgccaggatgatcccagctaccgttcttttcac
tctggtggatatggccaggatgccttagggatggaccctatgatggagcatgagatgggt
ggccaccaccctggtgctgactatccagttgatgggctgccggatctggggcatgcccag
gacctcatggatgggctgcccccaggggacagcaatcagctggcctggtttgatactgac
ctgtaa

DBGET integrated database retrieval system