KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103747569
Entry
103747569         CDS       T03372                                 

Gene name
Icam1
Definition
(RefSeq) intercellular adhesion molecule 1
  KO
K06490  intercellular adhesion molecule 1
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04064  NF-kappa B signaling pathway
ngi04514  Cell adhesion molecules
ngi04650  Natural killer cell mediated cytotoxicity
ngi04668  TNF signaling pathway
ngi04670  Leukocyte transendothelial migration
ngi04933  AGE-RAGE signaling pathway in diabetic complications
ngi05143  African trypanosomiasis
ngi05144  Malaria
ngi05150  Staphylococcus aureus infection
ngi05164  Influenza A
ngi05166  Human T-cell leukemia virus 1 infection
ngi05167  Kaposi sarcoma-associated herpesvirus infection
ngi05169  Epstein-Barr virus infection
ngi05323  Rheumatoid arthritis
ngi05416  Viral myocarditis
ngi05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    103747569 (Icam1)
   04668 TNF signaling pathway
    103747569 (Icam1)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    103747569 (Icam1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    103747569 (Icam1)
   04670 Leukocyte transendothelial migration
    103747569 (Icam1)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    103747569 (Icam1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103747569 (Icam1)
   05416 Viral myocarditis
    103747569 (Icam1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    103747569 (Icam1)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    103747569 (Icam1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103747569 (Icam1)
   05164 Influenza A
    103747569 (Icam1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103747569 (Icam1)
   05169 Epstein-Barr virus infection
    103747569 (Icam1)
  09174 Infectious disease: parasitic
   05144 Malaria
    103747569 (Icam1)
   05143 African trypanosomiasis
    103747569 (Icam1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ngi04147]
    103747569 (Icam1)
   04090 CD molecules [BR:ngi04090]
    103747569 (Icam1)
   00536 Glycosaminoglycan binding proteins [BR:ngi00536]
    103747569 (Icam1)
   04091 Lectins [BR:ngi04091]
    103747569 (Icam1)
Exosome [BR:ngi04147]
 Exosomal proteins
  Proteins found in most exosomes
   103747569 (Icam1)
CD molecules [BR:ngi04090]
 Proteins
  103747569 (Icam1)
Glycosaminoglycan binding proteins [BR:ngi00536]
 Hyaluronan
  Cell surface receptors
   103747569 (Icam1)
Lectins [BR:ngi04091]
 I-type lectins (Siglecs)
  103747569 (Icam1)
SSDB
Motif
Pfam: ICAM_N Ig_2 Ig_3 ig C2-set_2 I-set AMA-1
Other DBs
NCBI-GeneID: 103747569
NCBI-ProteinID: XP_008848282
LinkDB
Position
Un
AA seq 612 aa
MPKSWFRREGVSFPGNQRHQHRPSLWGPASIKNRAGSPCGVPTQHFCPAVLPPARCLGLA
MAPTRTRSLLPLLLALATVLMSGPGDAQISIFPKEAFLQRGTSLQVNCSTSCNQTFTLGL
ETKLPKTELASGHNWKLFELTDIEEDSRPLCFENCGTIQASASAYVTVYSFPESVELDPL
PSWQPVGKNLTLRCQVHGGVPRAQLTAVLLRGEVELSRQPVTGNPRDLTEITVTVLASRD
DHQANFSCRTELDLRRQGVALFQNISESRQLQTFELPVTLPKLDTPVILEVGTQHLVLCS
LQGLFPASEAQVHLEVGGQRLNPTTTGSRDLVSATAPLEVTAELEGTQQLRCVVELAEQT
LEAQETLSIYSFPAPTLTLSEPEVSEGGPVTVKCEAHGRSLVVMLTSAPAGPRSREIQLT
LNASSRLPSPEIQFTLNASAEDHKRRFFCSAALKVAGQVLYKNLTMELHVLYGPRLDESD
CLGNWTWPERSQQTLKCQAWGNPFPKLTCIRETDGALLPIGLVKTVKREMNGTYMCHAVN
SQGNVTRAVFLTVLYHHQNNLVIIILVTLAAILVPMATAIYLYNRQRKIKIYKLQKAQEE
TAMKLKTQATPP
NT seq 1839 nt   +upstreamnt  +downstreamnt
atgcctaagtcctggttccggagggaaggcgtgagctttccgggaaaccagaggcaccag
caccgcccctcgctctgggggccggcgagtataaagaaccgtgcaggctctccgtgcgga
gtccccacccagcacttctgcccagcagtgctgccacctgcacgctgccttggacttgct
atggctcctactcgcaccaggtccctgctgcctctgctactggccttggccaccgttctg
atgtcagggcctggtgatgctcaaatatccatcttccccaaagaagccttcctacaacga
gggacgtccttgcaggtgaactgctccacctcctgtaaccagaccttcaccctgggctta
gagaccaagcttcccaaaacagaactggccagtgggcacaactggaagctgtttgaactg
actgacatcgaggaagacagccgtccactgtgctttgagaactgcggcaccatccaggcc
tcagcctccgcatacgtcactgtgtactcctttccagaaagtgtggagctggaccctctg
cccagctggcagccagtaggcaaaaacctcactctgcggtgccaggtgcatggtggagtt
ccccgggcccagctcactgcagtgctgctccgtggggaggtggagctgagccggcagcct
gtgacaggtaaccccagagacctcactgagatcacagtcaccgtgctggccagcagagac
gaccaccaagccaatttctcctgccgcacagagctcgatctcaggagacaaggagtggcc
ctgtttcagaatatctcagagtccaggcaactccaaacttttgagctgcctgtgacccta
ccgaagctggacaccccagttatcctggaggtgggcactcagcacctggtgctctgctcc
ctgcaaggcctgtttccagcctctgaagctcaggtccacctggaggtggggggacaaaga
ctgaaccccaccaccacaggcagcagggacttggtgtctgccacagccccactagaggtg
actgcagagctggagggcactcagcagctgcggtgtgtggtggagctggcagaacagacc
ctggaggcccaggaaaccctgagcatctacagcttcccagctcccaccctaaccctgagt
gagcctgaggtctcagaaggaggcccagtcactgtgaagtgtgaagcccacggaagatcc
ctggtggtgatgttgaccagtgctccggccgggccacggtcccgggagatccagctcacg
ctgaatgccagctccaggctaccgtccccggagattcagttcacactgaatgccagcgcg
gaggatcacaagagacgctttttttgctcagctgccctgaaggtggctgggcaggtgctg
tacaagaacctgaccatggagctccatgtgctgtatggcccccgactggacgagagcgac
tgcttgggaaactggacatggccagaaaggtcccagcagactctgaaatgccaggcctgg
gggaacccattccccaagctcacctgtatccgggagacagatggcgccttgctacccata
gggctggtgaagactgtcaaacgggagatgaacggtacctacatgtgtcacgccgtgaac
tcccaagggaacgtcaccagggctgtgttcctgactgtgctctaccaccaccagaataac
ttggtcatcatcattttagtgacgttggcagccatcctggtccccatggccactgccatt
tatctttataatcgacagcgaaagatcaagatatacaagttgcagaaggctcaagaggag
acggccatgaaactcaagacacaagccacgcccccctga

DBGET integrated database retrieval system