KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103747824
Entry
103747824         CDS       T03372                                 

Gene name
Csf1
Definition
(RefSeq) colony stimulating factor 1
  KO
K05453  macrophage colony-stimulating factor 1
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04010  MAPK signaling pathway
ngi04014  Ras signaling pathway
ngi04015  Rap1 signaling pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04061  Viral protein interaction with cytokine and cytokine receptor
ngi04151  PI3K-Akt signaling pathway
ngi04380  Osteoclast differentiation
ngi04640  Hematopoietic cell lineage
ngi04668  TNF signaling pathway
ngi05010  Alzheimer disease
ngi05022  Pathways of neurodegeneration - multiple diseases
ngi05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103747824 (Csf1)
   04014 Ras signaling pathway
    103747824 (Csf1)
   04015 Rap1 signaling pathway
    103747824 (Csf1)
   04668 TNF signaling pathway
    103747824 (Csf1)
   04151 PI3K-Akt signaling pathway
    103747824 (Csf1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103747824 (Csf1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    103747824 (Csf1)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    103747824 (Csf1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103747824 (Csf1)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    103747824 (Csf1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103747824 (Csf1)
   05022 Pathways of neurodegeneration - multiple diseases
    103747824 (Csf1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103747824 (Csf1)
Cytokines and growth factors [BR:ngi04052]
 Cytokines
  CSF and other factors
   103747824 (Csf1)
SSDB
Motif
Pfam: CSF-1
Other DBs
NCBI-GeneID: 103747824
NCBI-ProteinID: XP_008848590
LinkDB
Position
Un
AA seq 554 aa
MTSRGAVGRCPSSSWLGPQLLLVCLLVSRSIAKEVSEHCSHMIGNGHLQFLQQLIDSQMQ
TSCQIVFEFVDKEQLDDPVCYLKKAFFLVQDIMEDTMRFKDNTPNANATERLQELSLRLK
SCFTKDYDEQDKACVRTFRETPLQMLEKIKNIFNETKNLLEKDWNIFSKNCNNSFAKCSS
QGVVTKPDCNCLYPKAMPSSDLASASPQQPLAPSMAPMAGLAWDDSQGIEGNSLLSSEQP
LRTEDPGNTKQRPPRSTCQSLESQETPSHKDSLTEGSPQPYPSVGGPIPGVEDILESVVG
TNWALEEASGEASEGLLPQEVKPSPSKPVGGSIQAETTRSSDLSASSPLPASAEDKQPTD
VPGTPFAEADPMKLTGQTQNHTPEKKDSSSTLLREHQEPGFPHTAAQSPQGLSNLATLSA
QPLFPRSHSWGIVLPLRELEGKRSFRDRRSLAELEEGPASEGAARPLAHFNSIPLTDTGH
QANPMGSIDPQLPGFVFHLLVPSIILVLLAVGGLLFYRWKWRSHREPQTSDSSVGQPEGS
LLTQDEDRQMELPV
NT seq 1665 nt   +upstreamnt  +downstreamnt
atgacctcgcggggcgccgtggggcgctgcccttcctcgtcatggctgggcccccagcta
ctgctggtctgtctcctggtgagcagaagtattgccaaggaggtgtcagagcactgtagt
cacatgattgggaatggacacttgcaattcctgcagcagctgatcgacagccaaatgcag
acctcatgccagattgtctttgaattcgtagacaaggaacagctggatgatcctgtttgc
taccttaagaaggcatttttcctggtacaagatataatggaagacaccatgcgctttaaa
gacaatacccccaatgccaatgcaactgagcggctccaggaactctctctgaggctgaag
agctgcttcaccaaggattatgatgagcaggacaaggcctgtgtccgaacttttcgtgag
actcctctccagatgctggagaagatcaagaatatctttaatgaaacaaagaatctcctt
gaaaaggactggaatattttcagcaagaactgcaacaatagctttgctaagtgctctagc
caaggtgtggtgaccaagcctgattgcaactgcctgtaccccaaagccatgcctagcagt
gacctggcctctgcctcccctcagcagcccctcgccccctccatggcccctatggctggc
ttggcttgggatgattctcaggggatagagggcaactccctcttgtccagtgagcagcct
cttcgcacagaggacccaggcaataccaagcagcgaccacccaggagcacctgccagagc
ctcgagtcacaggagaccccaagtcacaaggacagcctcactgagggttcaccacagcct
tacccttctgtggggggccccatccctggggtggaggacattctcgaatctgtagtaggc
actaactgggccctagaagaggcctctggagaggccagtgagggtcttttgccacaggag
gtaaagccttccccctccaagccagtagggggcagtatccaggcagagacaaccagatcc
agtgacctatcagcatcttctccactccctgcatcagcagaggacaaacagccaacggat
gtgccaggcacccccttcgcagaggcggaccccatgaaactcactggccagacccagaat
cacactcctgagaagaaagacagttcatctactctgcttagagagcaccaggagccaggc
tttcctcacactgcagcacagagtccccaaggcctcagcaacctggccaccctctctgct
cagccactgttccccagaagccactcatggggcattgtcctgcccctcagggaactggag
ggcaagaggagcttcagggatcggagaagcctggcagagctggaagaaggaccagcaagt
gagggggcagccaggcctctggcccattttaactccattcctttgactgacacaggccat
caggcgaatcccatgggatccatcgacccccagctccctggatttgtcttccatctgctg
gtgcccagcatcatcctggtcttgctagcggtcgggggtctcctgttctacaggtggaag
tggaggagccatcgagagcctcagacatcggattcttctgtggggcagccagagggcagc
ctcctgacccaggatgaggacagacaaatggaactgcctgtatag

DBGET integrated database retrieval system