KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103748829Help
Entry
103748829         CDS       T03372                                 

Gene name
Phldb2
Definition
(RefSeq) pleckstrin homology like domain family B member 2
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
SSDB OrthologParalogGFIT
Motif
Pfam: PH PH_11 PH_8
Motif
Other DBs
NCBI-GeneID: 103748829
NCBI-ProteinID: XP_008849838
LinkDB All DBs
Position
Un
AA seq 1209 aa AA seqDB search
MAEYCYEQKQLELQNGSLEEGFVVLSLGNEPQNTMESLSPRKYSSSLKFKANGDYSGSYL
TLSQPVSTRRSPSPLGINVRSSPSLAKIQGSKQFTNDGTDRNVSTKPPTPLLSSAASLGY
PLGRADFDHYTNRDSERPLRLSEKPPYSKYSSRNKSHDNVYFLGGLEGRKASGSLLTMWN
GSSLSDAGTSPISRSGAASMPSSPKQARKMNLQDNLTLQPKLARHKEPASENITVRTRKY
SGSSLSHMGAYSRSLPRLYKATENQMAPLSLLPRTSLGNSKRGRRGEKDLPHSIVDNDNY
LNFSSLSSGASPYKTSMSEGNPYVSSTLSVPASPRVARKMLLASTSSDDFDKASYSGTSP
SHSFTAEEPDRMFVSKRNFSCGSVELDDSDLDSLRQSSGTPQPILRERKSSISSISGRDD
LMDYHRRQREERLREQEMERLERQRLETILSLCAEYTKPDSRCLSVGTTVADVQKINKEL
EKLQLSDEESVFEEALVCPDARYRCQRKGSLHDADLAGFGSLSQSNTSFLTPRGSRNDEL
LGDLTRTPPPPSAAFLKASNESSYLSILPKTPEDVSEKQRTQELAAMEDTRMVILNNLEE
LEQKIKDINDQMDESSRELDMECALLDGEQKSETTELMKEKEILDHLNRKIAELEKNIVG
EKTKEKVKLDAEREKLERLQELYSEQKTQLDNCPESMREQLQQQLKRDADLLDVESKHFE
DLEFQQLEHESRLDEEKENLTQQLLREVAEYQRNIVTRKEKISALKKQASHIVQQAQREQ
DHFVKEKNNLIMMLQREKENLCNLEKKYSSLTGGKGFPVNPNTLKEHFRSLEERKKQHKE
GLYLSDTLPRKKTTPSISPHFSSATMGRSAAPKTHLPLGQSNSCGSVLPHSLATMTKDSE
SRRMLRGRVNSSAGYNHQQMSEGQRQKPEFYNRTASESNVYLNSFHYPDHSYKDQAFDTL
SLDSSDSMETSISACSPDNISSASTSNIARIEEMERLLKQAHAEKTRLLESREREMEAKK
RALEEEKRRREVLEKRLQEETSQRQKLIEKEVKIREKQRAQARPLTRYLPVRKEDFDLRS
HVETAGHNIDTCFHVSITEKTCRGYLIKMGGKIKTWKKRWFVFDRNKRTFSYYADKHEAK
LKGVIYFQAIEEVYYDHLKNANKSPNPLLTFSVKTHDRIYYMVAPSPEAMRIWMDVIVTG
AEGYTHFLL
NT seq 3630 nt NT seq  +upstreamnt  +downstreamnt
atggcagaatactgttatgagcaaaagcagctggaattacaaaatggtagcttagaggaa
ggatttgtggtgctttccctggggaacgagccccaaaatacgatggagagtctaagccca
aggaaatactcttccagtctgaaatttaaagccaatggggactactctggctcctattta
actctctcacaaccggtgtctactaggaggagcccttctcctttgggcatcaatgtcaga
agcagcccctccttggccaaaatccagggaagcaaacaattcaccaatgatggaactgac
agaaatgtttccacaaaacctcccactcctttgctcagctctgcagcctctcttggatac
ccacttgggagagcagattttgatcattacaccaatcgggacagtgaaaggcccttgagg
ctctcagagaagcctccctattccaaatacagctctagaaataaatcacatgacaatgtc
tactttctcggaggactggaaggacgcaaagcatctggctccctcctgaccatgtggaat
ggaagttccttgagtgatgctggcacctcacccatcagcagatcaggggcagcaagcatg
ccttcaagtccaaagcaagccaggaagatgaaccttcaggataacttgactctgcagccc
aagttagccaggcataaggagccagcatctgaaaacatcactgtgagaactaggaagtat
tctgggagcagcttgagccacatgggagcatacagccgatcacttcctagattgtataaa
gccacagaaaatcagatggcccctctcagcctgcttccaagaacctccctgggcaattct
aaacgaggccggcggggggaaaaggatctacctcatagcatagtggataatgacaattac
cttaacttttcatctttaagctcgggagcgtcaccctataaaacctctatgtccgaaggc
aatccatatgtaagttccaccctcagtgtccctgccagccctcgagtggctaggaagatg
ctcctggcctccacctcctctgatgactttgacaaggcttcatactcagggaccagccca
agtcattcattcactgctgaagaaccagacagaatgtttgtgtccaagaggaacttctct
tgtggatctgtggaacttgatgattctgatttggacagcctcagacagtcctcaggaact
ccccagcctatcctccgagaacggaaaagcagcatcagttccatttcaggacgtgatgac
ctgatggattatcaccggcggcagagggaggagagactcagggaacaggagatggagcga
ttggagcggcagcgcttggaaaccatcctcagtctctgcgctgagtacacgaagcccgac
agtcgctgcctttccgttggcaccacggtggctgatgtgcagaaaatcaacaaggagctg
gagaagcttcagctgtcagatgaggagtctgtgtttgaggaggctctggtgtgcccggac
gccaggtacagatgccaacggaagggctctctccatgatgctgacttggcgggcttcggg
agcctcagtcagagcaacaccagcttcctgacccccaggggcagcaggaacgatgaactt
cttggtgacctcaccaggacacccccaccaccatcggctgcctttctgaaagcatccaac
gagtcttcctacctaagtatcctacccaagaccccagaggatgtaagtgagaagcagagg
acccaggagttggctgcaatggaagatacccggatggtgattctcaacaaccttgaagag
cttgaacagaaaatcaaagatataaatgaccaaatggatgaatcctccagagagttggat
atggaatgtgctcttttggatggagagcagaaatctgaaacaactgaactcatgaaggag
aaggagattttggatcatctaaaccggaaaatagcagaactcgaaaagaacattgttggt
gaaaagaccaaggagaaggtaaagcttgatgctgaaagggaaaaactagaaaggcttcag
gagctttactccgagcagaagacgcagctggacaattgtcctgagtccatgagggaacag
ttacagcaacaactcaagagggatgctgacctgttggatgttgaaagcaaacactttgaa
gacttggaatttcagcaacttgagcatgagagtcgtctggatgaagaaaaggagaactta
actcaacagctgcttcgtgaagtggcagaatatcaacggaacattgtcactagaaaggaa
aaaatttctgcactgaaaaagcaagccagtcacattgttcagcaggctcaaagggaacaa
gatcactttgtgaaagaaaagaacaatttaataatgatgctccaaagagaaaaggagaat
ctttgtaatttggaaaagaagtattccagcctcactggggggaaagggtttcctgttaac
cccaacactttaaaagagcactttagaagcctggaagaaaggaaaaaacagcacaaagaa
ggcctctatctgagtgatactttgcctcgaaagaaaaccacaccttccatctccccacac
ttcagcagtgctacaatggggagaagtgcggccccaaagactcacctgcctctggggcag
agcaacagctgtggcagcgtgctccctcactcattggcaaccatgaccaaggactcagag
tctcggaggatgctcagaggaagagtgaattcctcagcaggttataaccaccaacagatg
agtgaaggacaaagacagaaacctgaattttacaaccgtacggcatctgagtcaaatgtc
tacttgaatagtttccattatccagatcacagctacaaggaccaggcctttgacacattg
agcctggacagctccgatagcatggaaaccagcatctctgcctgctcacctgacaatatc
tctagtgctagcacatcaaatattgccaggatagaagaaatggagagactcttaaaacag
gcacatgcagaaaagacccggctgcttgaatccagggaacgggaaatggaagccaaaaaa
cgagctctggaagaagaaaaacggcgccgagaagttctggagaaacgactgcaagaagaa
accagccagaggcagaagttaatagaaaaagaagtgaagataagggagaaacagagggca
caggctcgtcctctgacacgctatctgcctgtccggaaggaagactttgatttgcggagc
cacgtagaaactgctggtcacaatattgacacctgttttcacgtatcaatcacagagaag
acctgccgaggatacctcatcaaaatgggtggaaaaattaaaacatggaaaaaacgttgg
tttgtttttgaccggaataagagaacgttttcttattatgcagacaagcatgaggctaaa
ttaaaaggagtaatatacttccaagccatcgaagaagtgtattatgatcacctcaagaat
gctaataagagtcctaatccattactcacctttagcgtcaagacacatgacagaatctat
tacatggtagctccatcacccgaggccatgcggatctggatggatgttatagtcacggga
gcagaaggatacacccacttcctgttgtag

DBGET integrated database retrieval system