KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103748852
Entry
103748852         CDS       T03372                                 

Definition
(RefSeq) epidermal growth factor receptor
  KO
K04361  epidermal growth factor receptor [EC:2.7.10.1]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi01521  EGFR tyrosine kinase inhibitor resistance
ngi01522  Endocrine resistance
ngi04010  MAPK signaling pathway
ngi04012  ErbB signaling pathway
ngi04014  Ras signaling pathway
ngi04015  Rap1 signaling pathway
ngi04020  Calcium signaling pathway
ngi04066  HIF-1 signaling pathway
ngi04068  FoxO signaling pathway
ngi04072  Phospholipase D signaling pathway
ngi04144  Endocytosis
ngi04151  PI3K-Akt signaling pathway
ngi04510  Focal adhesion
ngi04520  Adherens junction
ngi04540  Gap junction
ngi04630  JAK-STAT signaling pathway
ngi04810  Regulation of actin cytoskeleton
ngi04912  GnRH signaling pathway
ngi04915  Estrogen signaling pathway
ngi04921  Oxytocin signaling pathway
ngi04926  Relaxin signaling pathway
ngi04928  Parathyroid hormone synthesis, secretion and action
ngi04934  Cushing syndrome
ngi05160  Hepatitis C
ngi05163  Human cytomegalovirus infection
ngi05165  Human papillomavirus infection
ngi05171  Coronavirus disease - COVID-19
ngi05200  Pathways in cancer
ngi05205  Proteoglycans in cancer
ngi05206  MicroRNAs in cancer
ngi05210  Colorectal cancer
ngi05212  Pancreatic cancer
ngi05213  Endometrial cancer
ngi05214  Glioma
ngi05215  Prostate cancer
ngi05218  Melanoma
ngi05219  Bladder cancer
ngi05223  Non-small cell lung cancer
ngi05224  Breast cancer
ngi05225  Hepatocellular carcinoma
ngi05226  Gastric cancer
ngi05230  Central carbon metabolism in cancer
ngi05231  Choline metabolism in cancer
ngi05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103748852
   04012 ErbB signaling pathway
    103748852
   04014 Ras signaling pathway
    103748852
   04015 Rap1 signaling pathway
    103748852
   04630 JAK-STAT signaling pathway
    103748852
   04066 HIF-1 signaling pathway
    103748852
   04068 FoxO signaling pathway
    103748852
   04020 Calcium signaling pathway
    103748852
   04072 Phospholipase D signaling pathway
    103748852
   04151 PI3K-Akt signaling pathway
    103748852
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103748852
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103748852
   04520 Adherens junction
    103748852
   04540 Gap junction
    103748852
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103748852
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    103748852
   04915 Estrogen signaling pathway
    103748852
   04921 Oxytocin signaling pathway
    103748852
   04926 Relaxin signaling pathway
    103748852
   04928 Parathyroid hormone synthesis, secretion and action
    103748852
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103748852
   05206 MicroRNAs in cancer
    103748852
   05205 Proteoglycans in cancer
    103748852
   05230 Central carbon metabolism in cancer
    103748852
   05231 Choline metabolism in cancer
    103748852
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103748852
  09162 Cancer: specific types
   05210 Colorectal cancer
    103748852
   05212 Pancreatic cancer
    103748852
   05225 Hepatocellular carcinoma
    103748852
   05226 Gastric cancer
    103748852
   05214 Glioma
    103748852
   05218 Melanoma
    103748852
   05219 Bladder cancer
    103748852
   05215 Prostate cancer
    103748852
   05213 Endometrial cancer
    103748852
   05224 Breast cancer
    103748852
   05223 Non-small cell lung cancer
    103748852
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103748852
  09172 Infectious disease: viral
   05160 Hepatitis C
    103748852
   05171 Coronavirus disease - COVID-19
    103748852
   05163 Human cytomegalovirus infection
    103748852
   05165 Human papillomavirus infection
    103748852
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103748852
   01522 Endocrine resistance
    103748852
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ngi01001]
    103748852
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ngi04147]
    103748852
Enzymes [BR:ngi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     103748852
Protein kinases [BR:ngi01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   103748852
Exosome [BR:ngi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   103748852
  Exosomal proteins of pancreatic cancer cells
   103748852
  Exosomal proteins of bladder cancer cells
   103748852
SSDB
Motif
Pfam: Recep_L_domain Furin-like GF_recep_IV
Other DBs
NCBI-GeneID: 103748852
NCBI-ProteinID: XP_008849862
LinkDB
Position
Un
AA seq 544 aa
MLLSGTAGTALLALLAALLAAGGALEEKKVCQGTSNRLTQLGTFEDHFLSLQRMFNNCEV
VLGNLEITYVQRNYDLSFLKTIQEVAGYVLIALNTVEKIPLENLQIIRGNALYENTYALA
VLSNYGTNKTGLRELPMRNLQEILLGAVRFSNNPILCNVETIQWRDIVNIDFMSNMSMDL
QNHLSSCQKCDPGCPNGSCWGAGEENCQKLTKIICAQQCSRRCRGKSPSDCCHNQCAAGC
TGPRESDCLVCHKFRDEATCKDTCPPLMLYNPTTYQMDVNPEGKYSFGATCVKTCPRNYV
VTDHGSCVRACGPDNFEVEEDGVRKCKKCDGPCRKVCNGIGIGEFKDTLSINATNIKHFK
NCTAISGDLHILPVAFKGDSFTHTPPLDPKELNILKTVKEITGFLLIQAWPENWTDLHAF
ENLEIIRGRTKQHGQFSLAVVGLNITSLGLRSLKEISDGDVIISTNQNLCYANTINWKKL
FGTSSQKTKIQYNRAENDCKATGHVCNPLCSLEGCWGPEPRDCVSCQNVSRGRECVEKCN
ILDG
NT seq 1635 nt   +upstreamnt  +downstreamnt
atgctactctcggggactgcggggaccgcgctgctggcgctgctggccgcgctcctggcc
gcaggtggggcgctggaggaaaagaaagtttgccaaggcacgagtaacaggctcacccag
ctgggcacttttgaagaccactttctgagtctgcagaggatgttcaataactgtgaggtg
gtccttgggaatttggaaatcacttacgtgcaaaggaattatgacctttccttcttaaag
accattcaggaggttgctggctatgtgctcattgcactcaacactgtggagaagatccct
ttggagaacctgcagatcatcagaggaaatgctctatatgaaaacacctatgccttagcc
gtcctgtccaactacgggacgaacaaaactgggctgagggagctgcccatgcggaactta
caggaaatcctgcttggtgctgtgcgattcagcaacaaccctatcctctgcaatgtggag
actatccagtggagggacatcgtcaacatcgactttatgagcaacatgtcaatggactta
cagaaccatctgagcagctgccaaaaatgtgacccaggctgtcccaatggaagctgttgg
ggtgcaggagaggaaaactgccagaaactgaccaaaatcatctgtgcccagcagtgttcc
cggcgctgccgtggcaagtctcccagtgactgctgtcacaaccagtgtgccgctggctgc
acagggccccgagagagcgactgcctggtttgccacaagttccgggatgaggccacatgc
aaggatacctgcccaccgctcatgctgtacaaccccaccacataccagatggatgtcaac
cctgaggggaagtacagctttggtgccacctgtgtgaagacatgcccccgaaactacgtg
gtgacagatcatggttcatgtgtccgcgcctgcggtcctgataactttgaagtggaagaa
gacggtgttcgcaagtgtaaaaaatgtgatgggccctgtcgcaaagtttgcaatggcata
ggcattggtgaatttaaagacacactctccataaatgctaccaatatcaaacacttcaaa
aactgcactgccatcagtggagatctccacatcctgccggtggcatttaagggggactcc
ttcacacacactcctcctctagacccaaaggaactgaatatcctaaaaaccgtaaaggaa
ataacagggtttttgctgattcaggcttggcctgaaaactggactgaccttcatgctttt
gagaacctagaaattatacgtggcaggacaaagcaacatggtcagttttctcttgcggtt
gtcggcctgaacataacatcattgggattgcgttcccttaaggaaataagtgatggtgat
gtgataatttcaacaaaccaaaatttgtgttatgcaaatacaataaactggaaaaaacta
tttgggacttccagtcagaaaaccaaaattcaatacaacagagctgaaaatgactgcaag
gctacaggccacgtctgtaatcctttatgttccctggaaggctgctggggccctgagccc
agggactgtgtctcctgccagaacgtcagccggggcagggaatgcgtggagaagtgcaac
atcctggatgggtga

DBGET integrated database retrieval system