KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103749361
Entry
103749361         CDS       T03372                                 

Gene name
Flt4
Definition
(RefSeq) fms related tyrosine kinase 4
  KO
K05097  FMS-like tyrosine kinase 4 [EC:2.7.10.1]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04010  MAPK signaling pathway
ngi04014  Ras signaling pathway
ngi04015  Rap1 signaling pathway
ngi04020  Calcium signaling pathway
ngi04151  PI3K-Akt signaling pathway
ngi04510  Focal adhesion
ngi05200  Pathways in cancer
ngi05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103749361 (Flt4)
   04014 Ras signaling pathway
    103749361 (Flt4)
   04015 Rap1 signaling pathway
    103749361 (Flt4)
   04020 Calcium signaling pathway
    103749361 (Flt4)
   04151 PI3K-Akt signaling pathway
    103749361 (Flt4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103749361 (Flt4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103749361 (Flt4)
  09162 Cancer: specific types
   05224 Breast cancer
    103749361 (Flt4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ngi01001]
    103749361 (Flt4)
Enzymes [BR:ngi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     103749361 (Flt4)
Protein kinases [BR:ngi01001]
 Receptor tyrosine kinases (RTK)
  VEGFR family [OT]
   103749361 (Flt4)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Ig_3 I-set Pkinase Ig_2 ig VEGFR-2_TMD V-set C1-set
Other DBs
NCBI-GeneID: 103749361
NCBI-ProteinID: XP_008850448
LinkDB
Position
Un
AA seq 1361 aa
MQPGSVLCLRLWLCLGLLDGLASGYSMTPPTLNITEESYIIDTGNSLSISCRGQHPLEWA
WPGAQEVLTAGGKDSEDTQVVQDCEGTEAKPYCKVLLLAQAHANNTGSYHCYYKYIKARI
EGTTAASTYVFVRDFEQPFINKPDTLLVNRKDAMWVPCLVSIPGLNITLRSQSSVLQPDG
QEVLWDDRRGMRVPTPLLRDALYLQCETTWGDQNFLSSPFLVHITGNELYDIQLFPKKSL
ELLVGEKLVLNCTVWAEFNSGVTFDWDYPGKQAERGKWVPERRSQQTHTELSSILTIHNV
SQQDLGPYVCEANNGIQRFRESTEVIVHEKPFISVEWLKGPVLEATAGDELVKLPVKLAA
YPPPEFQWYKDKKAVTGRHNPHALVLKDVTEASAGIYTLTLWNSAAGLRRNISLELVVNV
PPHIHEKEASSPSIYSRHSRQALTCTAYGVPPPLSVQWHWRPWTPCKTFTQRSLRRRQQR
DRMPQCRDWREVTTQDAVNPIESLDTWTEFVEGKNKTVSKLVIQDANVSAMYKCVVFNKV
GQDERLIYFYVTTIPDGFSIESEPSEDPLEGQSVRLSCRADNYTYEHLRWYRLNLSTLHD
AHGNPLLLDCKNVHLFATPLAASLEEAEPGARHATLSLNIPRVAPEHEGDYVCEVQDRRS
QDKHCHKKYLSVQALEAPRLTQNLTDLLVNVSDSLEMRCPVAGAHVPSIVWYKDERLLEK
ESGIDLADSNQRLSIQRVREEDAGRYLCSVCNAKGCVNSSASVAVEGSEDKGNMEIVILI
GTGVIAVFFWVLLLLIFCNMRRPTHADIKTGYLSIIMDPGEVPLEEQCEYLSYDASQWEF
PRERLHLGRVLGHGAFGKVVEASAFGINKGSSCDTVAVKMLKEGATASEHRALMSELKIL
IHIGNHLNVVNLLGACTKPNGPLMVIVEFCKYGNLSNFLRAKREAFNPYAEKSPEQRRRF
RAMVEGAKADRRRPGSSDRALLTRLLMGRGGVRRAPLVQEVEDLWLSPLTMEDLVCYSFQ
VARGMEFLASRKCIHRDLAARNILLSESDIVKICDFGLARDIYKDPDYVRKGSARLPLKW
MAPESIFDKVYTTQSDVWSFGVLLWEIFSLGASPYPGVQINEEFCQRLKDGTRMRAPELA
TPAIRHIMQSCWSGDPKARPAFSDLVEILGDLLQGRQEEEEECMALHSSQSSEEGGFMQT
STTALHITEADTEDSPPSVHRHSLAARYYNCVSFPGCLTRGTQTQGSSRMKTFEEFPMTP
TTYKASVDNQTDSGMVLASEEFEQIESRHRQEGGFSFKGPDQDMDVTRAHPDPQGRRRRP
TQGAQGGKVFYNSEYGELSQPCKEGDCSLSAGSPFFTDSGY
NT seq 4086 nt   +upstreamnt  +downstreamnt
atgcagccgggctccgtgctgtgcctgcgcctgtggctctgcctcggactcctggacggt
ctagcaagtggctactccatgacccctccaaccctgaacatcacagaggagtcatacatc
attgacaccgggaacagcctatccatatcctgcagggggcagcaccccctggagtgggcc
tggccaggagcccaggaggtactgactgcagggggaaaggacagcgaggacacacaggtt
gtgcaagactgcgagggcacagaagctaagccctactgcaaggtgctgctgctggcccag
gctcacgccaacaacacaggcagctaccactgctactacaagtacatcaaggcccgcatt
gagggcaccacagctgccagcacctatgtgtttgtgagagactttgaacagcccttcatc
aacaaacctgacacgctcctggtcaacaggaaggatgccatgtgggtgccctgcctggtg
tccatccctggcctcaacatcacactgcgctcgcaaagctcagtgctgcagcccgatgga
caagaggtgctgtgggatgaccgccggggcatgcgggtgcctacgccactgctgcgcgac
gccctgtacctgcagtgtgagaccacctggggcgaccagaactttctttccagtcccttc
ctcgtacacatcacaggcaatgagctctatgacatccagctgttccccaagaagtcactg
gagctgttggttggagagaagctggtcttgaactgcacagtatgggctgagttcaactca
ggtgtcacctttgactgggactacccagggaagcaggcagagcggggtaagtgggtacct
gagcggcgttcccagcagactcacacagagctctccagcatcctgaccatccacaatgtc
agccagcaagacctgggcccgtacgtgtgtgaggccaacaatggcattcaacgattccgg
gaaagcactgaggtcatcgtacacgaaaagcccttcatcagtgtcgagtggctcaaagga
cctgtcctggaggccacagccggtgacgagctggtgaagctgcctgtgaagctggcagca
taccccccgcctgaattccaatggtacaaggacaaaaaggcagtgaccggacgccacaac
ccacatgccctggtgctcaaagatgtgactgaggccagcgctggcatctacaccctcacc
ctctggaactctgcagctggtctgagacgcaacattagcctggagctggtggtgaatgtg
cccccccacatccacgagaaggaggcctcctcccccagtatctactcccgccacagccgc
caggccctcacctgcactgcctacggggtgcccccacctctcagtgtccagtggcactgg
cggccctggacaccctgcaagacctttacccagcgcagcctccggaggcgccagcagcga
gatcgcatgccacagtgccgagactggagggaggtgactacacaggacgctgtgaacccc
attgagagcctggacacctggactgagtttgtggaggggaagaataagacggtgagcaag
ctggtgattcaggatgccaatgtgtcagccatgtacaagtgtgtggtcttcaacaaggtg
ggccaggatgagcgcctcatctacttctatgtgaccaccatccccgacggcttcagtatc
gaatcagaaccttcggaggatcccttagaaggccagtccgtgcgcctcagctgccgggcg
gacaactacacatacgagcatctacgctggtaccggctcaacctatccacgctgcacgat
gctcatgggaacccgctgttgctggactgcaagaacgtgcacctgttcgccacgccccta
gcggccagcctagaggaggcggagcccggggcgcgccacgccaccctcagcctgaatatc
ccccgagtggcacccgagcatgagggcgactatgtgtgcgaggtgcaggaccggcgtagc
caagacaagcactgtcacaagaaatacctgtctgtgcaggccctggaagccccacggctc
acgcagaacttgaccgacctcctggtgaacgtgagcgactcactggagatgcggtgtcct
gtggccggagcgcatgtgcccagcattgtgtggtacaaggacgaaagactgctggagaaa
gagtcaggaatcgacctggcagactcgaaccagaggctgagcatccagcgcgtgcgcgag
gaggatgccggccgctatctatgcagcgtctgcaacgctaagggctgcgtgaactcctcg
gccagcgtggcggtggaaggctcagaggataaaggcaacatggagattgtgattctcatt
ggcactggcgtcatcgctgtcttcttctgggtcctcctcctcctcatcttctgtaacatg
agaaggcccacccatgcagacatcaagactggctacttgtccatcatcatggaccccggg
gaggtgcctttggaggagcagtgtgaatacctgtcctatgatgccagccaatgggagttc
cccagggaacggctgcacctcgggagagtcttaggtcacggggctttcgggaaggtcgtg
gaagcctcagcctttggcatcaacaaaggcagcagctgtgacaccgtggccgtgaaaatg
ctgaaagagggcgccacggccagcgagcaccgtgccttgatgtcggagctcaagatccta
atccacattggtaaccacctcaatgtggtcaacctcctaggggcgtgcaccaagcccaat
ggccccctcatggtgattgtggagttctgcaagtatggcaacctctccaacttcttgcgc
gccaagcgggaggccttcaacccctacgcagagaagtctccagagcaacgaaggcgcttc
cgcgcaatggtggaaggcgccaaggctgaccggcggagacctgggagcagcgacagggct
ctactcaccaggctcctgatgggcaggggaggggtgcggcgggcgcctctagtccaagaa
gttgaagacctatggctgagcccactgaccatggaagaccttgtctgctacagcttccaa
gtggcccggggaatggagttcctggcctcccggaagtgcattcacagagacctggccgct
cggaacatcttactgtcagaaagtgacatagtgaagatctgtgactttggtctcgctcgg
gacatctacaaagatcctgactatgtccgaaagggcagcgcccgactgcctctgaagtgg
atggcccctgagagcatctttgacaaagtgtacaccacacagagtgatgtgtggtccttc
ggagtgctgctctgggagatcttctccttgggggcttccccataccctggggtgcagatt
aatgaggagttctgccagcggctgaaggatggcacacggatgagggccccggagctggcc
actccagccatacgccacatcatgcagagctgttggtctggagatcccaaagcaaggcct
gccttctccgatctggtggagatcctgggggacctgctccagggccgacaggaggaagag
gaggagtgtatggccctgcacagctctcagagctcggaggaaggtggcttcatgcagaca
tccaccacagctctacacatcactgaagctgacactgaggacagtccccccagtgtgcat
cgccacagcctggcagccagatattacaattgtgtatcctttcccgggtgcctgaccaga
ggaactcagacacagggttcttctaggatgaagacatttgaagaattccccatgactcct
acgacctacaaagcctctgtggataaccagacggacagtggcatggtgctggcctcagag
gagtttgagcagatagaaagcaggcatagacaagaaggtggcttcagctttaaaggacct
gaccaggatatggatgtgaccagagcacaccctgacccccaggggagacgtaggcggccc
acccagggggcacaaggaggcaaggtgttttacaacagtgaatatggggagctctcccag
ccatgcaaggaaggtgactgctccctgtctgctggctcacccttcttcacagacagcggt
tactga

DBGET integrated database retrieval system