KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103749467
Entry
103749467         CDS       T03372                                 

Gene name
Igf1r
Definition
(RefSeq) insulin like growth factor 1 receptor
  KO
K05087  insulin-like growth factor 1 receptor [EC:2.7.10.1]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi01521  EGFR tyrosine kinase inhibitor resistance
ngi01522  Endocrine resistance
ngi04010  MAPK signaling pathway
ngi04014  Ras signaling pathway
ngi04015  Rap1 signaling pathway
ngi04066  HIF-1 signaling pathway
ngi04068  FoxO signaling pathway
ngi04114  Oocyte meiosis
ngi04140  Autophagy - animal
ngi04144  Endocytosis
ngi04150  mTOR signaling pathway
ngi04151  PI3K-Akt signaling pathway
ngi04152  AMPK signaling pathway
ngi04211  Longevity regulating pathway
ngi04213  Longevity regulating pathway - multiple species
ngi04510  Focal adhesion
ngi04520  Adherens junction
ngi04550  Signaling pathways regulating pluripotency of stem cells
ngi04730  Long-term depression
ngi04913  Ovarian steroidogenesis
ngi04914  Progesterone-mediated oocyte maturation
ngi05200  Pathways in cancer
ngi05202  Transcriptional misregulation in cancer
ngi05205  Proteoglycans in cancer
ngi05214  Glioma
ngi05215  Prostate cancer
ngi05218  Melanoma
ngi05224  Breast cancer
ngi05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103749467 (Igf1r)
   04014 Ras signaling pathway
    103749467 (Igf1r)
   04015 Rap1 signaling pathway
    103749467 (Igf1r)
   04066 HIF-1 signaling pathway
    103749467 (Igf1r)
   04068 FoxO signaling pathway
    103749467 (Igf1r)
   04151 PI3K-Akt signaling pathway
    103749467 (Igf1r)
   04152 AMPK signaling pathway
    103749467 (Igf1r)
   04150 mTOR signaling pathway
    103749467 (Igf1r)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103749467 (Igf1r)
   04140 Autophagy - animal
    103749467 (Igf1r)
  09143 Cell growth and death
   04114 Oocyte meiosis
    103749467 (Igf1r)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103749467 (Igf1r)
   04520 Adherens junction
    103749467 (Igf1r)
   04550 Signaling pathways regulating pluripotency of stem cells
    103749467 (Igf1r)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    103749467 (Igf1r)
   04914 Progesterone-mediated oocyte maturation
    103749467 (Igf1r)
  09156 Nervous system
   04730 Long-term depression
    103749467 (Igf1r)
  09149 Aging
   04211 Longevity regulating pathway
    103749467 (Igf1r)
   04213 Longevity regulating pathway - multiple species
    103749467 (Igf1r)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103749467 (Igf1r)
   05202 Transcriptional misregulation in cancer
    103749467 (Igf1r)
   05205 Proteoglycans in cancer
    103749467 (Igf1r)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103749467 (Igf1r)
   05214 Glioma
    103749467 (Igf1r)
   05218 Melanoma
    103749467 (Igf1r)
   05215 Prostate cancer
    103749467 (Igf1r)
   05224 Breast cancer
    103749467 (Igf1r)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103749467 (Igf1r)
   01522 Endocrine resistance
    103749467 (Igf1r)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ngi01001]
    103749467 (Igf1r)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ngi04090]
    103749467 (Igf1r)
Enzymes [BR:ngi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     103749467 (Igf1r)
Protein kinases [BR:ngi01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   103749467 (Igf1r)
CD molecules [BR:ngi04090]
 Proteins
  103749467 (Igf1r)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain Pkinase Furin-like fn3 Kinase-like Insulin_TMD DUF4476
Other DBs
NCBI-GeneID: 103749467
NCBI-ProteinID: XP_008850569
LinkDB
Position
Un
AA seq 1368 aa
MKSGSGGGSPTSLWGLVFLSAALSLWPTSGEICGPGIDIRNDYQQLKRLENCTVIEGFLH
ILLISKAEDYRSYRFPKLTVITEYLLLFRVAGLESLGDLFPNLTVIRGWKLFYNYALVIF
EMTNLKDIGLYNLRNITRGAIRIEKNADLCYLSTVDWSLILDAVSNNYIVGNKPQKECGD
LCPGTLEEKPICEKTTINNEYNYRCWTTNRCQKMCPSVCGKRACTENNECCHPECLGSCH
TPDDNTTCVACRHYYYKGVCVPACPPGTYRFEGWRCVDRDFCANIQSAESTDSYGFVIHD
GECMQECPSGFIRNSTQSMYCIPCEGPCPKVCGDEEKKTKTIDSVTSAQMLQGCTILKGN
LLINIRRGNNIASELENFMGLIEVVTGYVKIRHSHALVSLSFLKNLRMILGEEQLEGNYS
FYVLDNQNLQQLWDWNHRNLTIKSGKMYFAFNPKLCVSEIYRMEEVTGTKGRQSKGDINT
RNNGERASCESDVLRFTSTTTWKNRIIITWHRYRPPDYRDLISFTVYYKEAPFKNVTEYD
GQDACGSNSWNMVDVDLPPNKEGEPGILLHGLKPWTQYAVYVKAVTLTMVENDHIRGAKS
EILYIRTNASVPSIPLDVLSASNSSSQLIVKWNPPSLPNGNLSYYIVRWQRQPQDGYLYR
HNYCSKDKIPIRKYADGTIDVEEVTENPKTEVCGGDKGPCCACPKTEAEKQAEKEEAEYR
KVFENFLHNSIFVPRPERKRRDVMQVANTTMSSRSRNTTVTDIYNITDPEELETEYPFFE
SRVDNKERTVISNLRPFTLYRIDIHSCNHEAEKLGCSASNFVFARTMPAEGADDIPGPVT
WEPRPENSIFLKWPEPENPNGLILMYEIKYGSQVEDQRECVSRQEYRKYGGAKLNRLNPG
NYTARIQATSLSGNGSWTDPVFFYVPAKTTYENFIHLIIALPVAILLIVGGLVIMLYVFH
RKRNNSRLGNGVLYASVNPEYFSAADVYVPDEWEVAREKITMNRELGQGSFGMVYEGVAK
GVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIM
ELMTRGDLKSYLRSLRPEIENNPVLSPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAAR
NCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTHSDVWSFG
VVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSF
LEIISSIKDEMEPGFREVSFYYSEENKPPEPEELELEPENMESVPLDPSASSASLPLPDR
HSGHKAENGPGPGVLVLRASFDERQPYAHMNGGRANERALPLPQSSTC
NT seq 4107 nt   +upstreamnt  +downstreamnt
atgaagtctggctccggaggagggtccccgacctcgctgtgggggctcgtgtttctctcc
gccgcgctctcgctctggccgacgagtggagaaatctgtgggcctgggatcgacatccgc
aatgactatcagcagctgaagcgtctggagaactgcacggtgattgagggcttcctccat
atcctgctcatctccaaggctgaggactaccgcagctaccgcttccccaagcttacagtc
atcaccgaatacttgctgctgtttcgtgttgccggcctcgagagcctgggagatctcttc
ccgaacctcacggtcatccgtggctggaaactcttctacaactacgcactggtcatcttt
gagatgaccaacctcaaggatattgggctttataatctgaggaacattactcggggggct
atcaggattgagaaaaatgctgacctctgttacctctccacggtggactggtccctcatc
ttggatgctgtgtccaataactacattgtggggaacaagccccagaaggagtgtggggac
ctgtgtccagggaccttggaggagaagccaatctgcgagaagaccaccatcaataatgaa
tacaactaccgctgttggaccacaaatcgctgccagaaaatgtgccctagtgtgtgtggg
aagcgagcatgcacggagaacaatgagtgctgccacccagaatgcctgggcagctgccac
acacctgatgacaacacaacctgcgtggcctgccggcactactactacaaaggcgtgtgc
gtgcctgcctgcccgcctggcacctacaggtttgagggctggcgctgtgtggaccgagat
ttctgtgccaacatccagagtgctgagagcactgactcctatggcttcgttatccacgac
ggcgagtgtatgcaggagtgcccctcaggcttcatccgcaacagcacccagagcatgtac
tgcatcccctgtgaaggcccttgccccaaggtctgtggtgatgaagaaaagaaaacaaaa
accatcgattcagttacttctgctcaaatgctccaaggatgtaccatcttgaagggcaat
ttgcttattaatatccggcgaggcaataacatcgcctcagaactggagaatttcatgggg
ctcatcgaggtggtgacgggctatgtgaagatccgccattcccacgccctggtgtctttg
tcctttctgaaaaacctccgcatgatcttaggagaggagcaactggaaggaaactattcc
ttttatgtcctggacaaccagaacttgcagcagctgtgggactggaaccaccgcaacctg
accatcaagtcagggaagatgtactttgctttcaatcccaagctgtgtgtttctgaaatt
taccgcatggaggaagtaacaggaacaaaagggcgccagagcaaaggggacataaacacc
aggaacaacggagagcgagcctcctgtgaaagtgatgttctgcgtttcacctcaaccacc
acctggaagaaccgcattatcataacctggcaccggtaccgaccccccgactacagggat
ctcatcagcttcacggtttactacaaggaggcaccttttaaaaatgttacagaatatgat
gggcaggatgcctgtggctctaacagctggaacatggtggatgtggacctgcctcccaac
aaggagggggagcccggcattttattgcatgggctgaagccctggacccagtacgccgtc
tatgtcaaggctgtgaccctcaccatggtggaaaacgaccatatccgtggggccaagagt
gaaatcttatacattcgcaccaatgcttcagtaccttccattcccctggatgttctttca
gcatcaaactcctcctctcagctgattgtaaagtggaatcccccatctctgcccaacggg
aacctgagttactacattgtgaggtggcagcggcagccacaggatggctacctctacagg
cacaactactgctccaaagacaaaatccccatcagaaagtatgctgacggcaccattgat
gtggaagaggtgacagaaaatcccaagaccgaagtgtgtggtggggataaaggaccatgc
tgtgcttgtcccaaaactgaagctgagaagcaggccgagaaggaggaggctgagtaccgc
aaagtcttcgagaatttccttcacaactccatcttcgtgcccagacctgaaaggaaacgg
agagatgtcatgcaagtggccaacaccaccatgtccagtcgaagcaggaacaccacggtg
actgacatctataatatcacagacccagaagagcttgagacagaataccctttcttcgag
agcagagtggataataaggagagaactgtcatttccaacctccgacctttcactctatat
cgcatcgatatccacagctgcaaccacgaggctgagaagctgggctgcagtgcctccaac
tttgtctttgcaagaaccatgcctgcagaaggagcagatgatattcctggaccagtgact
tgggaaccaaggcctgaaaactccatctttttaaagtggccagaacctgagaaccctaac
ggattgattctcatgtatgaaataaaatacggatcacaagttgaggatcagcgggaatgt
gtgtccagacaggagtacaggaagtatggaggggccaagcttaaccggctaaacccaggg
aactatacagcccggattcaggctacctctctctctgggaatgggtcatggacggatcct
gtgttcttctatgtcccggccaaaacaacgtatgagaatttcatccatctgatcattgct
ctgccggtcgccatcctgctgatcgtgggcgggctggtgatcatgttgtacgtcttccat
aggaagagaaataacagcagattggggaatggggtgctgtatgcctctgtgaacccagaa
tatttcagtgcagccgatgtgtacgtgcctgatgaatgggaggttgctcgagagaagatc
accatgaaccgggagcttgggcagggatcctttgggatggtctatgaaggagtggccaag
ggtgtggtcaaggacgaacctgaaaccagggtagccatcaagacagtaaatgaggctgca
agcatgcgtgaaaggatagagtttctgaacgaggcctcagtgatgaaggagttcaactgt
caccatgtggtgcggttgctgggcgtggtgtcccagggccagcctaccctggtcatcatg
gaactaatgacacgcggggatctcaaaagttatctcaggtctctgaggccagaaatagag
aataatccagtcctatcacctccaagtttaagcaagatgatccagatggctggagagatt
gcagatggcatggcatacctcaatgcgaacaagtttgtccacagagatcttgctgcgcgg
aattgcatggtagctgaagatttcaccgtcaaaattggagattttggtatgacacgagac
atctatgagacagactactaccggaaaggagggaaggggttactgcctgtgcgctggatg
tctcctgagtccctcaaggatggagtcttcactactcattcagatgtctggtcctttggt
gtcgtcctctgggagattgccacattggctgagcagccataccaaggcttgtccaatgag
caagtccttcgcttcgtcatggagggtggccttctggacaaaccggacaactgccccgac
atgctatttgaactgatgcgcatgtgctggcagtacaaccccaagatgcggccttccttc
ctggagatcatcagcagcatcaaggacgagatggagcccggctttcgagaggtctccttc
tactacagcgaggagaacaagccacccgagccggaggagctggagctggagcccgagaac
atggagagcgtccccctggacccttcggcctcctcagcctccctgccactgcctgataga
cactcaggacacaaggccgagaacggcccaggccctggagtgctggttctccgcgccagc
ttcgatgagagacagccttatgcgcacatgaacgggggtcgagccaacgagagggccttg
ccgctgccccagtcttcgacctgctga

DBGET integrated database retrieval system