KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103749659Help
Entry
103749659         CDS       T03372                                 

Gene name
Sdha
Definition
(RefSeq) succinate dehydrogenase complex flavoprotein subunit A
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi00020  Citrate cycle (TCA cycle)
ngi00190  Oxidative phosphorylation
ngi01100  Metabolic pathways
ngi01200  Carbon metabolism
ngi04714  Thermogenesis
ngi04932  Non-alcoholic fatty liver disease (NAFLD)
ngi05010  Alzheimer disease
ngi05012  Parkinson disease
ngi05016  Huntington disease
Module
ngi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ngi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ngi_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    103749659 (Sdha)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    103749659 (Sdha)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    103749659 (Sdha)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    103749659 (Sdha)
   05012 Parkinson disease
    103749659 (Sdha)
   05016 Huntington disease
    103749659 (Sdha)
  09167 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    103749659 (Sdha)
Enzymes [BR:ngi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     103749659 (Sdha)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 Pyr_redox_2 GIDA FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 103749659
NCBI-ProteinID: XP_008850704
LinkDB All DBs
Position
Un
AA seq 664 aa AA seqDB search
MAGLGAVSRLLRGRRLTLAWAWPATFRIQTCGFHFTVGGSKKASAKVSDAISTQYPVVDH
EFDAVVVGAGGAGLRAAFGLSEAGFNTACLTKLFPTRSHTVAAQGGINAALGNMEEDNWR
WHFYDTVKGSDWLGDQDAIHYMTEQAPASVVELENYGMPFSRTEDGKIYQRAFGGQSLKF
GKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMENGECRGVIALCIE
DGSIHRIKAKNTVIATGGYGRTYFSCTSAHTCTGDGTAMITRAGLPCQDLEFVQFHPTGI
YGAGCLITEGCRGEGGILINSQGERFMERYAPVAKDLASRDVVSRSMTLEIREGRGCGPE
KDHVYLQLHHLPPEQLATRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYKGQ
VLKIVNGQDQIVPGLYACGEAACASVHGANRLGANSLLDLVVFGRACALSIAESCRPGDK
VPSVRPNAGEESVMNLDKLRFADGSIRTSELRLNMQKSMQNHAAVFRVGSVLQEGCKKIS
QLYGDLKHLKTFDRGMVWNTDLVETLELQNLMLCALQTIYGAEARKESRGAHAREDFKVR
VDEYDYSKPIEGQQKRPLEEHWRKHTLSYVDTKTGKVTLEYRPVIDKTLNEADCATVPPA
IRSY
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atggccgggcttggcgcagtgtcgcggctgctgcgcgggcggcgcttgacgctggcctgg
gcgtggccagcaacattccgaatacagacctgtggctttcacttcactgttggtgggagc
aagaaggcatctgcaaaagtttcagatgcaatttctactcagtacccagtagtggatcat
gaatttgatgctgtggtggtaggcgctggaggggcaggcttgagagctgcatttggtctt
tctgaggcagggtttaatactgcatgccttacaaagctctttcctacccggtcacacact
gttgcagcacagggaggcatcaatgctgctctggggaacatggaagaggacaactggagg
tggcatttctatgacactgtgaagggctctgactggctgggagatcaagatgccatccat
tatatgacagagcaggcccctgcttctgtggttgagctagaaaattatggaatgccattt
agcagaactgaagatgggaagatttatcagcgtgcgtttggtggacagagcctcaagttt
gggaaaggcggacaggctcatcgttgctgctgtgtggctgatcggacaggccactcactc
ttacacactttgtatggaaggtctctgcggtatgacaccagctattttgtggagtatttt
gccttggatctcctgatggaaaatggggagtgccgtggtgtcattgcactgtgcatagag
gatgggtccatacaccgcataaaagcaaagaacactgttattgctactggaggctatggg
cggacttacttcagctgcacatctgcccacacctgcactggggatggcacagccatgatc
accagggctggcttgccttgccaagatttagagtttgttcagttccaccccacaggtata
tatggtgctggctgtctcatcacagaaggatgccgtggagagggaggcattctcatcaac
agtcagggtgaaaggttcatggagagatatgcccctgttgccaaggacctggcatccaga
gatgttgtgtctcggtccatgactctggagatccgtgaaggaagaggctgtggccctgag
aaagatcatgtctaccttcagttgcaccacctgccccctgagcagttggccacacgccta
cctggaatttcagagacagccatgatctttgctggtgtggatgtcaccaaagagcccatc
cccgtcctccccactgtgcactacaacatgggtgggattcccaccaattacaagggacag
gtgctgaaaattgtgaatggccaggatcagattgtgcctggcctgtatgcctgtggggaa
gctgcctgtgcctcagtgcatggtgcaaaccggcttggagcaaattctctattggacctg
gtagtctttggtcgagcctgtgccctgagcattgcagaatcttgcaggcctggagataaa
gttccttcagttaggccaaatgctggagaagaatctgtcatgaatcttgataagttgaga
tttgctgatgggagcataagaacatcagaactgcgcctcaacatgcagaagtcaatgcag
aaccatgctgcagtgttccgtgtgggaagtgtattgcaagaaggctgtaaaaaaatcagc
caactctatggagacctgaaacatctaaagacatttgacagaggaatggtctggaacacg
gacctggtagagaccctggagctgcagaacctgatgctgtgtgcactgcagaccatctat
ggtgcagaggcacggaaggagtcacggggtgctcatgccagggaagatttcaaggttcgg
gttgatgagtatgattactccaagcccatcgaggggcagcagaagaggccattggaggaa
cattggagaaagcacactctctcatatgtggacaccaagacagggaaggtcactctggag
tacagacctgtcattgacaagaccttgaatgaggctgactgtgccacagtaccccctgcc
atccgctcctactga

DBGET integrated database retrieval system