KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103750125
Entry
103750125         CDS       T03372                                 

Gene name
Il3ra
Definition
(RefSeq) interleukin 3 receptor subunit alpha
  KO
K04737  interleukin 3 receptor alpha
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04151  PI3K-Akt signaling pathway
ngi04210  Apoptosis
ngi04630  JAK-STAT signaling pathway
ngi04640  Hematopoietic cell lineage
ngi05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103750125 (Il3ra)
   04151 PI3K-Akt signaling pathway
    103750125 (Il3ra)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103750125 (Il3ra)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    103750125 (Il3ra)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    103750125 (Il3ra)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103750125 (Il3ra)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ngi04050]
    103750125 (Il3ra)
   04090 CD molecules [BR:ngi04090]
    103750125 (Il3ra)
Cytokine receptors [BR:ngi04050]
 Interleukin receptor families
  IL3 receptor family
   103750125 (Il3ra)
CD molecules [BR:ngi04090]
 Proteins
  103750125 (Il3ra)
SSDB
Motif
Pfam: IL6Ra-bind IL3Ra_N EpoR_lig-bind
Other DBs
NCBI-GeneID: 103750125
NCBI-ProteinID: XP_017658659
LinkDB
Position
Un
AA seq 823 aa
MWCLALNPAGPDPGLGLLHPQVQLHAVALLEFLFLLFLLIGTSCGGDQHLARGGDSPVVN
LTLDVRRKTLTWNYETHVTRHTCNVTTRVDPSTVTEPLLRGGSWLCWFPNARFHGGAVLT
VGGETEDGRAFEEVLFFHNSGKEGSGAVNFSCVIYDIRFMNCTWAPGPAAPVDVQYRLCA
WLSRDAEAQECAQYLPGRLGCHFPELGAPRTTDDYVFLVDGTSRTDAVAFVDFAPLSAVM
LEKYNPPENLTVAHEDSGTVIRWENPERRFNLAPSTFWYQLHIQSQGSSQEREPICQRGH
ERNEYRVPSTESKTEHTCIYIHALKSTGTTHLTAGSHFLCHLCAAAVGGVTSASISTLRP
QIRVRVPGGSSLRQRLCPSIPKVKVELAEGFCPGAEFPGRPWGAQAGRGGRPRPPEAELR
TQLRFYGRKLLNRAQTAPTMAPLWLLVLLTPGSVLLTPDPDPGAPGPFRNLRLEPNERRL
SWEMDAHGPTGSPVLCQKDAQNPVVASQQTCTFYTLSLCNITRFTVYVRDDPATSTWIRF
PKDDPNRGAAASNLQCWVYHTDTLTCTWEPGRTAPGDVQYRLFWRKAGSGRDQDQECLHY
GQDTLGRNVRCDVSNVSLVSHLLMVTVNGSSQQEPVSCSDRSVHLKSVEVLSPPEITAQC
NRTHALMRWSMRSLFPRTFTYHLEIRQSSTFVSNTTTKETSFVLLHPGTFTVRIRAKSDE
QIRYTAWSARQSFVCDDSADTQVLTVALLVSLGMVLMALVTLLLLCRRSSLWQSLCPPIP
KVKGLLTQGDPEVTWVEANLPESLQEPEEFLRVEEAAGRPPAT
NT seq 2472 nt   +upstreamnt  +downstreamnt
atgtggtgcttagcactgaatcctgcaggtcctgaccctggtcttggtctgttgcatccc
caggtccagctccacgctgtggccctgctggagttcctcttcctcctgttccttctgatt
ggcacatcctgtggaggagaccagcacctggcccgaggtggagactcgccggtcgtgaac
ctgacgctcgacgtccggaggaaaacgctgacgtggaattacgagacccacgtcacgcgt
cacacatgcaacgtcaccacccgcgtggacccctccacggtcactgagcctctgctccgc
ggcggctcgtggctctgctggtttccgaacgcgcggttccacggaggcgcggtgctgacg
gtgggcggcgagaccgaggacggcagagcgttcgaggaagtcctcttcttccacaactca
gggaaggaagggtccggggccgtgaacttctcctgcgtcatctacgacatccggttcatg
aactgcacgtgggcgccgggccccgcggcgcccgtggacgtccagtaccgcctgtgtgct
tggttgtccagggacgccgaggcgcaggaatgcgctcagtacctccccggccgcctcggc
tgccacttcccggagctcggggcgccgcggaccacggacgactacgtgttcctggtagac
gggaccagtcgcacagacgccgtggccttcgtggactttgctcccctttccgccgtgatg
ctcgaaaagtacaatcctcctgaaaacctgacggtcgcccacgaagattcggggaccgtc
atccggtgggaaaacccggagaggcgattcaacttagcaccgagcaccttctggtaccaa
cttcacatccaaagccagggaagctcccaggagagagaaccgatttgtcaacgcggacat
gagagaaatgagtaccgagtacccagtaccgagtcgaagacagagcacacctgcatttac
atacatgcactcaagtccactggcaccacccacctcaccgcgggttcccacttcctctgc
catctctgtgcagctgctgtgggcggggtgacatcagcatccatctccaccctgaggccc
cagatccgggttcgggtcccgggagggtcctccctgaggcagaggctatgcccgtccatc
cccaaggtgaaagtggagctggccgagggcttctgtcctggtgccgagtttcccgggcgg
ccttggggtgcacaggcggggcggggggggagaccccgacccccggaggccgagctgagg
acgcagctgcgtttctatggccggaagttgctcaaccgcgctcagactgcgcccaccatg
gcccccctgtggctcctcgtcctgctgacgccggggtctgttttgctgacccctgaccct
gacccgggtgcgcccggccctttcaggaacctgcgactggagcccaacgagcgtaggctg
agctgggagatggatgcacacggccccactggttcgccagtcctgtgtcagaaggatgca
cagaatccggtggtggcttctcagcagacgtgcacgttctacacgctgtccttgtgcaac
atcacccggttcaccgtctacgtgcgggacgacccggccacatccacctggatccgcttc
cccaaggacgatcccaaccgcggggctgcggcctccaacctgcagtgctgggtgtaccac
accgacaccctgacctgcacctgggagcccggccgcacggcccccggcgacgtgcagtac
cggctgttctggaggaaggcgggttccgggagggaccaggaccaggagtgtctgcactac
ggccaggacaccctggggcgcaacgtgcgctgtgacgtcagcaacgtctccctggtctcc
cacctgctcatggtgacggtgaacggatccagccagcaggaaccagtgtcctgcagcgac
cgatccgtgcatctgaagagtgtagaggtgctgagtcctcccgagatcacggcccagtgt
aacagaacccacgcgctcatgcgctggagcatgaggagcctcttccctcggacgttcact
taccacctggagatccggcagagctcaacttttgtgtccaacacgacgaccaaggaaacc
tccttcgtcctgctgcatccgggaaccttcaccgtccggatccgcgcgaagtcggatgag
cagatccgctacaccgcctggagcgctcggcagtcgtttgtgtgcgacgactctgcggac
acccaggtgctgactgtggcgctgctggtgtccctggggatggtgctcatggccttggtg
accctattgctgttgtgcagaaggtcctccctgtggcagtcgctgtgcccccccatcccc
aaggtgaaagggctgctgacacaaggtgatcccgaggtcacatgggtggaggcaaatctt
ccagaaagtctgcaggagcctgaggaattcctccgggtggaagaagctgcagggcgtcca
ccagcaacatga

DBGET integrated database retrieval system