KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103750144
Entry
103750144         CDS       T03372                                 

Gene name
Cish
Definition
(RefSeq) cytokine inducible SH2 containing protein
  KO
K04701  cytokine inducible SH2-containing protein
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04630  JAK-STAT signaling pathway
ngi04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103750144 (Cish)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    103750144 (Cish)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ngi04121]
    103750144 (Cish)
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:ngi04990]
    103750144 (Cish)
Ubiquitin system [BR:ngi04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     103750144 (Cish)
Domain-containing proteins not elsewhere classified [BR:ngi04990]
 Src homology (SH) domain-containing proteins
  Other SH2 and SH3-containing proteins
   103750144 (Cish)
SSDB
Motif
Pfam: SH2 SOCS_box
Other DBs
NCBI-GeneID: 103750144
NCBI-ProteinID: XP_008851319
LinkDB
Position
Un
AA seq 253 aa
MVLCVQGSCPLLAVEQIRQRPQWAQSLKLPGPVMQPLPAGAFPEEVAEEIQSEPKVLDPE
EDLLCIAKTFSYLRESGWYWGSITASEARQHLQKMPEGTFLVRDSTHPSYLFTLSVKTTR
GPTNVRIEYADSSFRLDSNCLSRPRILAFPDVVSLVQHYVASCAADTRSDSPDPVPTPAL
PMPKQDAPGDPALPVPMATAVHLKLVQPFVCRSSARSLQHLCRLVINRLVADVDCLPLPR
RMANYLRQYPFQL
NT seq 762 nt   +upstreamnt  +downstreamnt
atggtcctttgcgtacagggatcttgtcctttgctggctgtggagcagatcaggcagcgg
cctcagtgggcccagtccctaaagctgcctgggccagtcatgcagcccttgcccgcaggg
gccttcccagaggaggtggcagaggagatccagagtgaaccaaaggtgctggaccctgag
gaagatctgctatgcatagccaagactttctcctacctccgagagtctgggtggtactgg
ggttccattactgccagtgaggctcggcaacacttacagaagatgccagaaggcacattc
ctagtacgagatagcacccatcccagctacctgttcacgctgtcagtcaaaaccacccgt
ggccccaccaatgtacgcatcgagtacgctgactccagcttccgactagactccaactgc
ttgtccagacctcgaatcctcgccttcccagatgtggtcagccttgtgcagcactatgtg
gcctcctgtgctgctgacaccaggagtgacagcccagatcctgttcccaccccagcccta
cctatgcctaagcaagatgcacctggagacccagcgctgcctgtccccatggctactgct
gtgcacctgaaattggtgcagccctttgtatgcaggagcagtgcccgcagcttacagcac
ctgtgccgcctcgtcatcaacagattggtagctgatgtggactgcctaccactgccccgg
cgcatggccaactaccttcgacagtaccctttccagctctga

DBGET integrated database retrieval system