KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103750153
Entry
103750153         CDS       T03372                                 

Gene name
Rassf1
Definition
(RefSeq) Ras association domain family member 1
  KO
K09850  Ras association domain-containing protein 1
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04014  Ras signaling pathway
ngi04390  Hippo signaling pathway
ngi04392  Hippo signaling pathway - multiple species
ngi05200  Pathways in cancer
ngi05206  MicroRNAs in cancer
ngi05219  Bladder cancer
ngi05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    103750153 (Rassf1)
   04390 Hippo signaling pathway
    103750153 (Rassf1)
   04392 Hippo signaling pathway - multiple species
    103750153 (Rassf1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103750153 (Rassf1)
   05206 MicroRNAs in cancer
    103750153 (Rassf1)
  09162 Cancer: specific types
   05219 Bladder cancer
    103750153 (Rassf1)
   05223 Non-small cell lung cancer
    103750153 (Rassf1)
SSDB
Motif
Pfam: RA Nore1-SARAH C1_1 Mst1_SARAH
Other DBs
NCBI-GeneID: 103750153
NCBI-ProteinID: XP_008851338
LinkDB
Position
Un
AA seq 340 aa
MSAETELIELRELAPAGRTGPGRTRLERANALRIAPGTSRNPSQLQGPGRGHRFQPTGPA
THTWCDLCGDFIWGVVRKGLQCAYCKFTCHYRCRALVCLDCCGPRDLGWDPLLERDTNVD
EPVEWETPDLSQAEIEQRIKEYNGQINSNLFMSLNKDGSYTGFIKVQLKLVRPVSVPSSK
KPPSLQDTRRGPGRNTAVRRRTSFYLPKDAIKHLHVLSRTRAREVIEALLRKFLVVDDPR
KFALYEQAERHGQVYFRKLSDDEQPLKLRLLAGPSEKALSFVLKENDSGEVNWDAFSMPE
LHNFLRILQREEEEHLRQILQKYSHCRQKIQEALHACPLG
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgtcggcggagacagagctcattgagcttcgggaactggcacccgctgggcgtaccggc
ccaggccgcacccggctggagcgtgccaacgctctgcgcattgcgccgggcacctcgcgc
aacccgtcacagctgcagggcccgggtcgtggccaccgcttccagcctacagggcccgcc
acgcacacgtggtgcgacctctgtggagacttcatctggggcgtcgtgcgcaagggccta
cagtgcgcgtactgcaagttcacctgccattaccgttgccgcgctctcgtctgcttggac
tgctgcgggccccgagacctgggctgggaccccctgctggagcgggacacaaacgtggat
gagcctgtagaatgggagacacctgatctttctcaggctgaaattgagcagaggatcaag
gagtacaatggccagatcaacagcaacctcttcatgagcctgaacaaggatggatcctac
acaggcttcattaaggttcagctgaaactggtgcgccctgtctcagtaccttctagcaag
aaaccaccttctttacaggatacccggcggggcccagggcgcaacacagctgtgaggcgc
cgcacttccttttacctgcctaaggatgctatcaagcatctgcatgttctgtcacgcaca
cgggcacgtgaggtcattgaagccctgttgcgcaaattcttggtggtggatgatccccgt
aaatttgcactctatgaacaagctgaacggcatggccaagtgtacttccggaaactgtca
gatgatgagcagcccctgaagctacggcttcttgcagggcccagtgagaaggccttgagc
tttgtcctgaaagagaatgattctggggaagtgaattgggatgccttcagcatgcctgaa
ctacataacttcctgcgaatcctgcaacgggaagaagaagaacacctccgccagatcctg
cagaagtactctcattgccgccagaagatccaggaggccctgcacgcctgtcccttgggg
tga

DBGET integrated database retrieval system