KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103750740
Entry
103750740         CDS       T03372                                 

Gene name
Zfp36
Definition
(RefSeq) ZFP36 ring finger protein
  KO
K15308  tristetraprolin
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi05166  Human T-cell leukemia virus 1 infection
ngi05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103750740 (Zfp36)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103750740 (Zfp36)
Messenger RNA biogenesis [BR:ngi03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     103750740 (Zfp36)
SSDB
Motif
Pfam: zf-CCCH zf_CCCH_4 zf-CCCH_4 zf-CCCH_2 Torus
Other DBs
NCBI-GeneID: 103750740
NCBI-ProteinID: XP_008852182
LinkDB
Position
Un
AA seq 324 aa
MATRATMDLSAIYESLLSLSPELSSDLGGTEPSGLWSINSCDSPAPEVPSRLPGRSTSLV
ESRSCGWVPPPPGFAPLAPRPGPELSPSPTSPPATPTTSSRYKTELCRTFSESGRCRYGA
KCQFAHGLGELRQANRHPKYKTELCRKFYLQGRCPYGSRCHFIHNPNEDQASSPGHPHVL
RQSISFSGLPSGRRTSPPPPGLSALSLSSCSFSPSSSPPPAGDLPLSPSAFSAAPGTPVA
RRDPTPVCCPSCRRSTASIWGPLGGLARSPSAHSLGSDPDEYASSGSSLGGSDSPVFEAG
VFGPPQPPVSQRRLPIFNRISVSE
NT seq 975 nt   +upstreamnt  +downstreamnt
atggccactcgcgccaccatggatctctctgccatctatgagagcctcctgtcgctgagc
cctgaattgtcatccgacctcggaggaactgagccctcgggactttggagcatcaactct
tgtgactcgcctgcgcctgaggttccctcccgcctacccggccgctccaccagcctggtg
gagagccgaagctgtggctgggtccccccgcctcccggcttcgcacccttggctccccgc
ccgggccctgaactgtcgccctcacccacttcacctcctgcgactcccaccacctcgtcc
cgctacaagaccgaactctgccggaccttctcagagagcggccgctgtcgctacggggcc
aagtgccagtttgcgcacggcctcggggagctgcgccaggccaatcgccaccccaagtat
aagactgaactttgccgcaagttctacctccagggccgctgtccctacggttcgagatgc
cacttcatccacaaccccaacgaggaccaggcctcctcccccggacacccccatgtgctg
cgtcagagcatcagcttctctggcttgccctccggccgcagaacctcaccgcctccgcca
ggcctgtccgctctatccttgtcctcctgttccttctcgccctccagctccccgcctcca
gccggggaccttcccctttctccctctgccttctctgctgcccctggaacccctgtggct
cgaagggaccccactccagtctgttgcccctcctgccgaaggtctactgccagcatctgg
ggtcccttgggtggcctggcgcgcagcccatccgcacactcgctgggatccgaccctgat
gaatacgccagcagtgggagcagcctggggggctcagactcacctgtctttgaagccggg
gtgtttgggcctccccagccccctgtaagccaacgtcgactccccatcttcaatcgcatc
tcggtttctgagtga

DBGET integrated database retrieval system