KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103750879
Entry
103750879         CDS       T03372                                 

Gene name
Pax8
Definition
(RefSeq) paired box 8
  KO
K09293  paired box protein 8
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04918  Thyroid hormone synthesis
ngi05200  Pathways in cancer
ngi05202  Transcriptional misregulation in cancer
ngi05216  Thyroid cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    103750879 (Pax8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103750879 (Pax8)
   05202 Transcriptional misregulation in cancer
    103750879 (Pax8)
  09162 Cancer: specific types
   05216 Thyroid cancer
    103750879 (Pax8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ngi03000]
    103750879 (Pax8)
Transcription factors [BR:ngi03000]
 Eukaryotic type
  Helix-turn-helix
   Paired box domain only
    103750879 (Pax8)
SSDB
Motif
Pfam: PAX Pax2_C HTH_23 HTH_32 HTH_Tnp_IS1 Ribosomal_S13_N HTH_38
Other DBs
NCBI-GeneID: 103750879
NCBI-ProteinID: XP_008852376
LinkDB
Position
Un
AA seq 457 aa
MPHNSIRSGHGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVRPCDISRQLRVSHGCVSK
ILGRYYETGSIRPGVIGGSKPKVATPKVVEKIGDYKRQNPTMFAWEIRDRLLAEGVCDND
TVPSVSSINRIIRTKVQQPFNLPMDSCVATKSLSPGHTLIPSSAVTPPESPQSDSLGSTY
SINGLLGIAQPGGDNKRKMDDSDQDSCRLSIDSQSSSSGPRKHLRTDTFSQHHLEPLECP
FERQHYPEAYASPSHTKGEQGLYPLPLLNSALDDGKATLTPSNTPLGRNLSTHQTYPVVA
DPHSPFAIKQETPELSSSSSTPSSLSSSAFLDLQQVGSGGPAGASVPPFNAFPHAASVYG
QFTGQALLSGREMVGPTLPGYPPHIPTSGQGSYASSAIAGMVAGSEYSGNAYSHTPYSSY
SEAWRFPNSSLLSSPYYYSSTSRPSAPPTTATAFDHL
NT seq 1374 nt   +upstreamnt  +downstreamnt
atgcctcacaactccatcagatccggccacggagggctgaaccagttgggaggggccttt
gtgaatggcagacctctgccggaagtggtccgccaacgcattgtggacctggcccaccag
ggtgtaaggccatgtgacatctctcgccagctccgtgtcagtcatggctgcgtcagcaag
atccttggcaggtactacgaaactggcagtatccgacctggagtgatagggggctccaag
cccaaagtggccacccccaaggtggtggagaagattggggactacaagcggcagaacccc
accatgtttgcctgggagattcgagaccgacttctggcagagggtgtttgtgacaatgac
actgtgcccagtgtcagctccatcaacagaataatccggaccaaagtgcagcaaccgttc
aacctccctatggacagctgcgtggccactaagtccctgagcccagggcacacgctgatc
cccagctcagctgtaacacccccagagtcacctcagtcagattctttgggttccacctac
tctatcaacgggctcctgggaattgctcagcctggcggtgacaacaagagaaagatggat
gacagtgaccaagacagttgtcggctgagcatcgactcacagagtagcagcagcggtccc
cgaaagcaccttcgcaccgacaccttcagccagcaccacctcgagccgcttgagtgccca
tttgagcggcagcactacccggaggcctatgcctcccctagccacaccaaaggcgagcag
gggctctacccactgcccttgctcaacagtgccctggacgatgggaaggctaccctgaca
ccttccaatacacctctgggacgcaacctctcaactcaccagacctaccctgtggtggca
gatcctcattcacccttcgccataaagcaggaaaccccagagctgtccagttctagctcc
accccttcctctttatctagctccgcctttttggatctgcagcaagtcggctctgggggc
ccagcaggtgcctcggtcccacccttcaatgcctttccccatgctgcctccgtgtatggg
cagttcacgggccaggccctcctctcagggcgagagatggtggggcccacgctgcctgga
tacccaccccacatccccaccagtggacagggaagttatgcctcctctgccatcgcaggc
atggtggcaggaagtgaatactccggcaatgcctacagccacaccccctactcctcctac
agcgaggcctggcgcttccccaactccagcctgctgagttccccatattattacagctcc
acatcaaggccaagtgcaccgcccaccactgccacggcctttgaccatctgtag

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103751484
Entry
103751484         CDS       T03372                                 

Gene name
Pparg
Definition
(RefSeq) peroxisome proliferator activated receptor gamma
  KO
K08530  peroxisome proliferator-activated receptor gamma
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi03320  PPAR signaling pathway
ngi04152  AMPK signaling pathway
ngi04211  Longevity regulating pathway
ngi04380  Osteoclast differentiation
ngi04714  Thermogenesis
ngi05016  Huntington disease
ngi05200  Pathways in cancer
ngi05202  Transcriptional misregulation in cancer
ngi05216  Thyroid cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    103751484 (Pparg)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    103751484 (Pparg)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103751484 (Pparg)
  09149 Aging
   04211 Longevity regulating pathway
    103751484 (Pparg)
  09159 Environmental adaptation
   04714 Thermogenesis
    103751484 (Pparg)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103751484 (Pparg)
   05202 Transcriptional misregulation in cancer
    103751484 (Pparg)
  09162 Cancer: specific types
   05216 Thyroid cancer
    103751484 (Pparg)
  09164 Neurodegenerative disease
   05016 Huntington disease
    103751484 (Pparg)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ngi03000]
    103751484 (Pparg)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:ngi03310]
    103751484 (Pparg)
Transcription factors [BR:ngi03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone receptor-like
    103751484 (Pparg)
Nuclear receptors [BR:ngi03310]
 1. Thyroid hormone like
  1C. Peroxisome proliferator-activated receptor (PPAR)
   103751484 (Pparg)
SSDB
Motif
Pfam: PPARgamma_N zf-C4 Hormone_recep
Other DBs
NCBI-GeneID: 103751484
NCBI-ProteinID: XP_008853170
LinkDB
Position
Un
AA seq 427 aa
MVDTEMPFWPTNFGISSVDLSMMDDHSHSFDIKPFTTVDFSSISTPHYEDIPFTRADPVV
ADYKYDLKLQEYQSAIKVEPASPPYYSEKTQLYNRPHEEPSNSLMAIECRVCGDKASGFH
YGVHACEGCKGFFRRTIRLKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNGDQT
QGPVHVTCNMYILCHPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSV
EAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTR
EFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQ
DNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLHVIKKTETDMSLHPLLQ
EIYKDLY
NT seq 1284 nt   +upstreamnt  +downstreamnt
atggttgatacagagatgccattctggcccaccaacttcggcattagctctgtggacctc
tctatgatggatgaccactcccattcctttgacatcaaaccgttcaccacagttgatttc
tccagcatttctactccacactatgaagatattccgttcacaagagctgacccagtggtt
gctgattataaatatgacctgaagctccaagaataccaaagtgcaatcaaagtagaaccc
gcatccccaccctattattctgaaaagacccagctctacaacaggcctcatgaagagcct
tccaactccctcatggccattgagtgccgagtctgtggagataaagcttctggcttccac
tacggagttcatgcttgtgaaggatgcaagggtttcttccgaagaaccatcagattgaag
cttatttatgacaggtgtgatcttaactgtcggatccacaaaaaaagtagaaataaatgt
cagtactgtcggtttcagaagtgccttgctgtgggaatgtctcataatggagatcaaacc
cagggccctgtgcacgtaacatgtaacatgtatatactttgccacccatttgtcatctat
gacatgaattccttaatgatgggagaagataaaatcaagttcaaacacatcacccccctg
caggagcagagcaaagaagtggccattcgcattttccaggggtgccaatttcgttccgtg
gaagccgtgcaggagatcacagagtatgccaaaagtatccccggctttgtaaaccttgac
ttgaatgaccaagtaactctgctcaagtatggtgtccatgagatcatctacacaatgctg
gcctccctgatgaataaagatggggttctcatatcagagggccaagggttcatgaccagg
gagttcctcaagagcctacggaagccctttggtgactttatggagcccaagtttgagttt
gctgtgaagttcaatgcactggaattagatgacagcgacttggccatatttatagctgtc
attattctcagtggagaccgcccaggcttgctcaacgtgaaacccattgaggacatccag
gacaacctgctgcaggccctggaactccaactcaagctgaaccaccctgagtcctcacag
ctgtttgccaagctgctccagaaaatgacagacctcagacagatcgtcacggagcatgtg
cagctattgcacgtgatcaagaagactgagacggacatgagcctgcaccccctgctgcag
gagatctacaaggacttatattag

DBGET integrated database retrieval system