KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103751150Help
Entry
103751150         CDS       T03372                                 

Gene name
Tgm6
Definition
(RefSeq) transglutaminase 6
  KO
K05624  transglutaminase 6 [EC:2.3.2.13]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    103751150 (Tgm6)
Enzymes [BR:ngi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     103751150 (Tgm6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core FixG_C
Motif
Other DBs
NCBI-GeneID: 103751150
NCBI-ProteinID: XP_008852737
LinkDB All DBs
Position
Un
AA seq 724 aa AA seqDB search
MHDLSEPPVETTLMITHLEAGVRVTKVDWQHSKNGAAHHTQDYPCSELVVRRGQLFSLKL
GLNGVLESEEALIFTVETGPQASEALHTKVIFQTAELEIGDNWSAAKEEQTENSLTVSLI
SPSNAAIGRYLLSARASSRRKHSDRKLGEFVLLFNPWCPEDDVFLDSEEERQEYVLNDSG
IIFRGVEKHIRAQGWNYGQFEEDILNICLSILDRSPSHQSDPANDVSHRHDPVYVTRIIS
AMVNSNNDRGVIQGQWQGKYGGGTSPLRWRGSVTILQKWFKGRCKPVKYGQCWVFAGVMC
TVLRCLGIATRVVSNFNSAHDTDGNLSVDKYVDSFGRTLEDLTEDSMWNFHVWNESWFAR
QDLGPSYNGWQVLDATPQEESEGVFQCGPASVNAIREGDVHLAHDSPFVFAEVNADYITW
LWHEDEKRERVYSDTKKIGRCISTKAVGSDSRVDITGLYKYPEGSRKERQVYSKAVKKLL
SVEAWGRRTRIRRVSGRGLWRDDLLEPPVKPSITGKFKVLEPPVLGQDLRLALCLTNLTS
RPQRVRVNLSGATILYTRKPVAEILQESHTVRLGPQEEKKIPVTISYSQYKEDLTEDKKI
LLAAMCLVSKGEKLLVEKDITLEDFITIKVLGPAVVGVAVAVEVSVVNPLLESVKDCVLM
VEGSGLLQGQLSIDVPSLQPQESALVQFNITPSKSGPRQLQVDLISSKFPDIKGFVIIHV
ATAK
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgcatgacctttctgagcctccagtagaaacaactctgatgattactcatctagaagca
ggagtcagagttactaaggtggactggcagcattcaaaaaacggtgctgcccaccacacc
caggattacccttgttctgagctggtggttcgcaggggccagttattcagcctcaagctg
ggtctgaacggagtcctggagagcgaggaggcacttatcttcactgtggagacagggccc
caggcatctgaggcactccacaccaaagtcatattccagacagcagagctagagataggt
gacaactggtcagctgcaaaggaggaacagacagagaactccttgactgtcagcctcatc
agtccttccaatgcagcaatcggccgatacctgctgagtgccagggcctcttcccgccgg
aaacacagtgaccggaagctgggcgaatttgttctcctgttcaatccctggtgtccagag
gatgatgtgtttctggactcagaagaggagagacaggagtacgtgcttaatgacagtggc
atcatcttccgaggcgtggagaagcacatccgagcccagggttggaactacgggcagttt
gaggaggacatcctgaatatctgcctctccatcctggaccgaagccccagccaccagagt
gacccagccaacgatgtgtcccatcgccatgaccctgtttatgtcaccaggatcatcagt
gccatggtgaacagcaacaatgaccggggcgtgatacagggccagtggcagggcaaatac
ggtggtggcaccagcccactgcgctggcgtggcagcgtgaccattctgcagaagtggttc
aagggcaggtgcaagccagtcaaatatggccagtgctgggtcttcgctggagtcatgtgc
acagtcctcaggtgcctggggatcgcgaccagagtggtatccaacttcaactcagcccac
gacactgatggcaatctgagtgtggacaagtacgtggactctttcggccggaccctggag
gacttgactgaagacagcatgtggaatttccacgtctggaatgagagctggtttgcacgg
caggacctgggcccatcctacaacggctggcaggttctggatgccacgccgcaggaagag
agcgaaggcgtgttccagtgtggccctgcctcagtcaacgccatccgcgagggagatgtg
cacttggcccacgatagtcccttcgtgtttgccgaagtcaatgcagactacatcacctgg
ctgtggcatgaggacgaaaagagagaacgggtatactcagacacaaagaagatcgggagg
tgcatcagtaccaaggctgtaggcagcgactcgcgtgtggacatcacaggcctctacaag
tacccagaagggtcccggaaggagaggcaggtgtacagcaaggcggtgaagaagctgctc
agcgtggaagcctgggggaggaggactcgaatccgcagggtcagtgggcgtggtctctgg
cgtgatgacctcctggagcctcccgtcaagcccagcatcactggcaagttcaaagtgctg
gagccaccagttctgggccaggacctgaggttagctctctgcttgaccaacctcacctcc
aggccccagcgggtgcgagtcaatctgagcggagccaccatcctctatacccgcaagcca
gtggcagagatcctacaggaatcccacacagtgaggctggggccacaagaagagaagaag
atcccagtcacaatatcttactctcagtacaaagaagacctgacagaggacaagaagatc
ctgttggctgccatgtgccttgtcagtaaaggagagaagctcctggtagaaaaggacatt
actctagaagacttcatcaccatcaaggtgctgggcccagctgtagtgggagtggcagtt
gcagtggaagtatcagtggtcaaccccctcctggagagcgtgaaggactgtgtgctgatg
gtagagggcagtggccttctccaaggacaactcagcattgatgtgcccagcctgcagccc
caggagagcgcgttggtccagttcaacattaccccctccaagagtggcccaaggcaactg
caagtggatctcatcagctccaaattcccagatatcaagggctttgtgatcatccatgtg
gctacagccaagtga

DBGET integrated database retrieval system