KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103751498
Entry
103751498         CDS       T03372                                 

Gene name
Ccnd1
Definition
(RefSeq) cyclin D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi01522  Endocrine resistance
ngi04068  FoxO signaling pathway
ngi04110  Cell cycle
ngi04115  p53 signaling pathway
ngi04151  PI3K-Akt signaling pathway
ngi04152  AMPK signaling pathway
ngi04218  Cellular senescence
ngi04310  Wnt signaling pathway
ngi04340  Hedgehog signaling pathway
ngi04371  Apelin signaling pathway
ngi04390  Hippo signaling pathway
ngi04510  Focal adhesion
ngi04530  Tight junction
ngi04630  JAK-STAT signaling pathway
ngi04917  Prolactin signaling pathway
ngi04919  Thyroid hormone signaling pathway
ngi04921  Oxytocin signaling pathway
ngi04933  AGE-RAGE signaling pathway in diabetic complications
ngi04934  Cushing syndrome
ngi05160  Hepatitis C
ngi05162  Measles
ngi05163  Human cytomegalovirus infection
ngi05165  Human papillomavirus infection
ngi05166  Human T-cell leukemia virus 1 infection
ngi05167  Kaposi sarcoma-associated herpesvirus infection
ngi05169  Epstein-Barr virus infection
ngi05200  Pathways in cancer
ngi05203  Viral carcinogenesis
ngi05205  Proteoglycans in cancer
ngi05206  MicroRNAs in cancer
ngi05210  Colorectal cancer
ngi05212  Pancreatic cancer
ngi05213  Endometrial cancer
ngi05214  Glioma
ngi05215  Prostate cancer
ngi05216  Thyroid cancer
ngi05218  Melanoma
ngi05219  Bladder cancer
ngi05220  Chronic myeloid leukemia
ngi05221  Acute myeloid leukemia
ngi05222  Small cell lung cancer
ngi05223  Non-small cell lung cancer
ngi05224  Breast cancer
ngi05225  Hepatocellular carcinoma
ngi05226  Gastric cancer
ngi05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103751498 (Ccnd1)
   04340 Hedgehog signaling pathway
    103751498 (Ccnd1)
   04390 Hippo signaling pathway
    103751498 (Ccnd1)
   04371 Apelin signaling pathway
    103751498 (Ccnd1)
   04630 JAK-STAT signaling pathway
    103751498 (Ccnd1)
   04068 FoxO signaling pathway
    103751498 (Ccnd1)
   04151 PI3K-Akt signaling pathway
    103751498 (Ccnd1)
   04152 AMPK signaling pathway
    103751498 (Ccnd1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103751498 (Ccnd1)
   04115 p53 signaling pathway
    103751498 (Ccnd1)
   04218 Cellular senescence
    103751498 (Ccnd1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103751498 (Ccnd1)
   04530 Tight junction
    103751498 (Ccnd1)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    103751498 (Ccnd1)
   04921 Oxytocin signaling pathway
    103751498 (Ccnd1)
   04919 Thyroid hormone signaling pathway
    103751498 (Ccnd1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103751498 (Ccnd1)
   05206 MicroRNAs in cancer
    103751498 (Ccnd1)
   05205 Proteoglycans in cancer
    103751498 (Ccnd1)
   05203 Viral carcinogenesis
    103751498 (Ccnd1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103751498 (Ccnd1)
   05212 Pancreatic cancer
    103751498 (Ccnd1)
   05225 Hepatocellular carcinoma
    103751498 (Ccnd1)
   05226 Gastric cancer
    103751498 (Ccnd1)
   05214 Glioma
    103751498 (Ccnd1)
   05216 Thyroid cancer
    103751498 (Ccnd1)
   05221 Acute myeloid leukemia
    103751498 (Ccnd1)
   05220 Chronic myeloid leukemia
    103751498 (Ccnd1)
   05218 Melanoma
    103751498 (Ccnd1)
   05219 Bladder cancer
    103751498 (Ccnd1)
   05215 Prostate cancer
    103751498 (Ccnd1)
   05213 Endometrial cancer
    103751498 (Ccnd1)
   05224 Breast cancer
    103751498 (Ccnd1)
   05222 Small cell lung cancer
    103751498 (Ccnd1)
   05223 Non-small cell lung cancer
    103751498 (Ccnd1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    103751498 (Ccnd1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    103751498 (Ccnd1)
   04934 Cushing syndrome
    103751498 (Ccnd1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103751498 (Ccnd1)
   05162 Measles
    103751498 (Ccnd1)
   05160 Hepatitis C
    103751498 (Ccnd1)
   05163 Human cytomegalovirus infection
    103751498 (Ccnd1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103751498 (Ccnd1)
   05169 Epstein-Barr virus infection
    103751498 (Ccnd1)
   05165 Human papillomavirus infection
    103751498 (Ccnd1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103751498 (Ccnd1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C K-cyclin_vir_C
Other DBs
NCBI-GeneID: 103751498
NCBI-ProteinID: XP_008853184
LinkDB
Position
Un
AA seq 296 aa
MEHQLLCCEVESIRRAYPDSNLLTDRVLRAMLKAEETCAPSVSYFKCVQKEIVPSMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPLKKSRLQLLGATCMFVASKMKETIPLT
AEKLCVYTDNSIRPEELLQMELILVNKLKWNLAAMTPHDFIEHFLSKMPEVDENKQIIRK
HAQTFVALCATDVKFISNPPSMVAAGSVVAALQGLHLGSPNDFLSCYRTTHFLSRVIKCD
PDCLRACQEQIETLLESSLRQAQQNQDPKATEEEEEEEEEEAGLACTPTDVRDVHI
NT seq 891 nt   +upstreamnt  +downstreamnt
atggaacaccagctcctgtgctgcgaagtggagagcatccgccgcgcgtacccggactcc
aacctcctcaccgaccgcgtgctgcgcgccatgctgaaggcggaggagacctgcgcaccc
tcggtgtcctacttcaagtgcgtgcagaaggagatcgtgccgtccatgcgcaagattgtg
gccacctggatgctggaggtctgcgaggagcagaagtgcgaggaagaagtcttcccgctc
gccatgaactacctggaccgctttctgtccctggagcctctgaaaaagagccgtctgcag
ctgctgggggccacctgcatgttcgtggcctccaagatgaaggagaccatccccttgacg
gcggagaagctgtgcgtctacactgacaactccatccgacccgaggagctgctgcaaatg
gaactgattctggtgaacaaactcaagtggaacctggctgcgatgaccccccacgacttt
atcgaacatttcctctccaaaatgccagaggtggatgagaacaaacagatcatccgcaag
catgcgcagacctttgtggccctctgtgccacagatgtgaagttcatttccaacccgccc
tccatggtggctgctgggagtgtggtggccgcactgcagggcctgcacctgggcagcccc
aatgacttcctgtcctgctaccgcacaacacacttcctctccagagtgatcaagtgtgac
ccggactgtctccgtgcctgccaggagcagatcgaaacccttctagaatccagcctgcgc
caggcccagcagaaccaggaccccaaggccactgaggaggaggaggaggaggaagaggag
gaggccggcctggcctgcacacccaccgacgttcgggacgtgcacatctga

DBGET integrated database retrieval system