KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103751671Help
Entry
103751671         CDS       T03372                                 

Definition
(RefSeq) pancreatic alpha-amylase-like
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi00500  Starch and sucrose metabolism
ngi01100  Metabolic pathways
ngi04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    103751671
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    103751671
Enzymes [BR:ngi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     103751671
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase_C Alpha-amylase LSR
Motif
Other DBs
NCBI-GeneID: 103751671
NCBI-ProteinID: XP_008853393
LinkDB All DBs
Position
Un
AA seq 509 aa AA seqDB search
MKFLLLLSLVGFCWAQYHPPCTQCHRTSIVHLFEWRWVDIAKECERYLGPNGFGGVQVSP
PNENAVINNPSRPWWERYQPISYKICTRSGNENEFRDMVTRCNNVGVRIYVDAVINHMCG
SGNPAGTSSTCGSYYNPNNRDFPAVPYSGWDFNDGKCNGEINNYNDANEVRNCRLSGLLD
LALEKDYVRNTTANYMNHLIDIGVAGFRLDAAKHMWPEDIKAILDKLHNLNTTWFCPGSR
PFIFQEVIDLGGEAIKSSEYFGNGRVTEFKFGAKLGTVIRKWNGEKMAYLKNWGEGWGMM
PTDRALVFVDNHDNQRGHGAGGASILTFWDARMYKMAVGFMLAHPYGFTRVMSSYRWDRN
FVNGKDVNDWIGPPNNNGAIKEVTINADTTCGNGWVCEHRWRQIRNMVAFRNVVNGQPFA
NWWDNGSNQVAFGRGNRGFIVFNNDDWSLSAKLQTGLPAGTYCDVISGDKSNGSCTGIEV
QVSGDGTAQFSISNSAEDPFIAIHAESKL
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgaagttccttctgctgctctcactcgttgggttctgctgggcgcaatatcaccccccc
tgcactcagtgccaccggacttccatcgtccacctgtttgagtggcgctgggttgatatt
gccaaggaatgtgagcgatacttaggtcccaatggatttggaggggtccaggtctctcca
cctaatgaaaatgctgtgattaacaacccttcaaggccctggtgggaaagataccaaccg
attagctacaaaatctgcacaaggtctggaaatgaaaacgaattcagagacatggtgacg
aggtgcaacaatgttggtgtccgcatttatgtggatgccgtcatcaatcacatgtgcggc
tcaggcaaccccgcgggaacaagcagcacttgtggaagttactacaaccctaacaacagg
gactttccagcagttccgtactctggctgggattttaacgatggcaaatgcaatggagaa
attaataactataacgacgctaatgaggtcagaaattgtcgtctgtctggtcttctggat
cttgcccttgagaaagattatgttcgcaacacgactgctaactatatgaaccatctcatt
gacattggtgtggcagggttcagacttgatgctgctaagcacatgtggcctgaagacata
aaggcaattctggataaactgcataatctaaatacaacatggttctgtccaggaagtaga
ccattcatttttcaagaggttattgatctgggtggtgaggcaattaaaagcagtgagtac
tttggaaatggccgtgtgacagaattcaagtttggagcaaaactgggcacagttatccgc
aagtggaatggagagaagatggcttacttgaagaactggggagaaggttggggtatgatg
cctaccgacagagcccttgtctttgtggataaccatgataatcagagaggacatggggct
ggaggagcatccattctgacattctgggacgctagaatgtataaaatggctgttggattc
atgctggctcacccgtatggtttcacacgagtcatgtcaagttaccgttgggatcgaaat
tttgtgaatggaaaagatgttaatgattggattggaccaccaaataacaacggtgccatc
aaagaagtgaccattaatgcagataccacttgcggaaacggctgggtgtgtgagcatcgg
tggcggcaaatcaggaacatggttgccttcagaaatgtagttaatggccagccttttgca
aactggtgggacaatggtagcaaccaagtagcttttggaagaggaaacagaggcttcatt
gtctttaataatgatgactggtcactgtcagcaaagttacagactggtcttcctgctggc
acatactgtgatgtcatttctggagacaaaagcaatggcagttgcacaggaattgaagtc
caggtttctggggatggcacggctcagttttccataagtaactcagctgaggacccattt
attgccatccatgctgaatcaaaattataa

DBGET integrated database retrieval system