KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103751726Help
Entry
103751726         CDS       T03372                                 

Gene name
Gad1
Definition
(RefSeq) glutamate decarboxylase 1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi00250  Alanine, aspartate and glutamate metabolism
ngi00410  beta-Alanine metabolism
ngi00430  Taurine and hypotaurine metabolism
ngi00650  Butanoate metabolism
ngi01100  Metabolic pathways
ngi04727  GABAergic synapse
ngi04940  Type I diabetes mellitus
Module
ngi_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    103751726 (Gad1)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    103751726 (Gad1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    103751726 (Gad1)
   00430 Taurine and hypotaurine metabolism
    103751726 (Gad1)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    103751726 (Gad1)
 09160 Human Diseases
  09167 Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    103751726 (Gad1)
Enzymes [BR:ngi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     103751726 (Gad1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase DegT_DnrJ_EryC1 SepSecS OKR_DC_1
Motif
Other DBs
NCBI-GeneID: 103751726
NCBI-ProteinID: XP_008853459
LinkDB All DBs
Position
Un
AA seq 594 aa AA seqDB search
MASSTPSSSATSSNAGADPNTTNLRPTTYDTWCGVAHGCTRKLGLKICGFLQRTNSLEEK
SRLVSAFKERQSSKNLLSCENSDRDARFRRTETDFSNLFARDLLPAKNGEDQTVQFLLEV
VDILLNYVRKTFDRSTKVLDFHHPHQLLEGMEGFNLELSDHPESLEQILVDCRDTLKYGV
RTGHPRFFNQLSTGLDIIGLAGEWLTSTANTNMFTYEIAPVFVLMEQITLKKMREIIGWS
SKDGDGIFSPGGAISNMYSIMAARYKYFPEVKTKGMATVPKLVLFTSEHSHYSIKKAGAA
LGFGTDNVILIKCNERGKIIPADLEAKILEAKQKGYVPLYVNATAGTTVYGAFDPIQEIA
DICEKYNLWLHVDAAWGGGLLMSRKHRHKLSGIERANSVTWNPHKMMGVLLQCSAILVKE
KGILQGCNQMCAGYLFQPDKQYDVSYDTGDKAIQCGRHVDIFKFWLMWKAKGTVGFENQI
NKCLELAEYLYAKIKNREEFEMVFDGEPEHTNVCFWYIPQSLRGVPDSPERREKLHRVAP
KIKALMMESGTTMVGYQPQGDKANFFRMVISNPAATQSDIDFLIEEIERLGQDL
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcttccaccccttcttcgtccgcaacctcctcgaacgcgggagcagatccgaac
actactaacctgcgccctacaacgtacgatacttggtgtggcgtggcccatggatgcacc
agaaaactgggactgaagatctgtggcttcttacaaaggaccaatagtctggaagagaag
agtcgccttgtgagcgccttcaaagagaggcagtcctccaagaacctactttcctgtgaa
aacagtgaccgggatgcccgtttccggcgcacagagactgacttctccaacttgtttgct
cgagatctgcttccagctaagaatggagaggaccaaactgtgcagttcttgctggaagtg
gtcgacatactcctcaactatgtccgcaagacatttgatcgctctaccaaggtgctagac
ttccaccacccacaccagttgcttgagggcatggaaggctttaatttggagctctctgac
caccctgagtccctggagcagatcctggttgactgcagagacaccctaaaatacggggtt
cgtacaggtcaccctcgatttttcaaccagctctctactggattggatatcattggctta
gctggtgaatggctgacatcaactgccaataccaatatgtttacatatgaaattgcacca
gtatttgtcctcatggaacaaataacacttaagaagatgagagaaatcattggatggtca
agtaaagatggtgatgggatattttctcctgggggagccatatccaacatgtacagcatc
atggctgctcgctacaagtactttccggaagttaagacaaaaggcatggcaactgtgccc
aagctggtccttttcacctcagaacatagtcactattccataaagaaagctggggctgca
cttggctttggaaccgacaatgtgattttgataaagtgcaatgaaagggggaagataatt
ccagctgatttagaggcaaaaattcttgaagccaagcagaagggatatgttcccctctat
gtaaatgcaactgctggcacgactgtttatggagcttttgatccaatacaggagattgca
gacatatgtgagaaatacaacctttggctgcatgttgatgctgcctggggcggtggtctg
ctcatgtcccggaagcaccggcacaaacttagtggcatagaaagggccaactctgtcacc
tggaaccctcacaagatgatgggtgtgctgctacagtgctcagccattctagtcaaggag
aagggtatactacaaggatgcaaccagatgtgtgcaggatacctcttccagccagacaag
cagtatgatgtctcctatgacactggggacaaggcgatccagtgtggccgccatgtggac
atcttcaagttctggctgatgtggaaagcaaagggcactgtgggatttgaaaatcagatc
aacaaatgcttggagctggctgaatacctctatgccaaaattaaaaacagagaagaattt
gagatggtattcgacggcgagcctgagcacacaaatgtctgtttctggtatattccacaa
agtctccgcggagttccagatagtcctgagcgacgggaaaaactacacagggtggctccc
aagatcaaagccctgatgatggagtcaggcacaaccatggtcggataccagcctcagggg
gacaaagccaacttctttcggatggtcatctccaacccagctgctacccagtccgacatc
gacttcctcattgaggagatagaaaggctgggccaggatctataa

DBGET integrated database retrieval system