KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103751919
Entry
103751919         CDS       T03372                                 

Gene name
Brca1
Definition
(RefSeq) BRCA1, DNA repair associated
  KO
K10605  breast cancer type 1 susceptibility protein [EC:2.3.2.27]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi01524  Platinum drug resistance
ngi03440  Homologous recombination
ngi03460  Fanconi anemia pathway
ngi04120  Ubiquitin mediated proteolysis
ngi04151  PI3K-Akt signaling pathway
ngi05206  MicroRNAs in cancer
ngi05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    103751919 (Brca1)
  09124 Replication and repair
   03440 Homologous recombination
    103751919 (Brca1)
   03460 Fanconi anemia pathway
    103751919 (Brca1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    103751919 (Brca1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    103751919 (Brca1)
  09162 Cancer: specific types
   05224 Breast cancer
    103751919 (Brca1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    103751919 (Brca1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ngi01009]
    103751919 (Brca1)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ngi04121]
    103751919 (Brca1)
   03036 Chromosome and associated proteins [BR:ngi03036]
    103751919 (Brca1)
   03400 DNA repair and recombination proteins [BR:ngi03400]
    103751919 (Brca1)
Enzymes [BR:ngi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     103751919 (Brca1)
Protein phosphatases and associated proteins [BR:ngi01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     103751919 (Brca1)
Ubiquitin system [BR:ngi04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    103751919 (Brca1)
  Multi subunit Ring-finger type E3
   BRCC complex
    103751919 (Brca1)
Chromosome and associated proteins [BR:ngi03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Regulators of centriole replication
     103751919 (Brca1)
DNA repair and recombination proteins [BR:ngi03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    BRCA1-core complex
     103751919 (Brca1)
    BRCA1-A complex
     103751919 (Brca1)
    BRCA1-B complex
     103751919 (Brca1)
    BRCA1-C complex
     103751919 (Brca1)
    BRCA complex
     103751919 (Brca1)
   FA (Fanconi anemia) pathway
    Downstream FA components
     103751919 (Brca1)
SSDB
Motif
Pfam: BRCT_assoc BRCT BRCT_2 zf-C3HC4 zf-C3HC4_2 zf-C3HC4_4 zf-C3HC4_3 zf-RING_UBOX zf-RING_2 zf-RING_5 zf-Nse zf-RING_6 zf-RING_10 zf-ANAPC11 Prok-RING_4 zf-rbx1 RTT107_BRCT_5
Other DBs
NCBI-GeneID: 103751919
NCBI-ProteinID: XP_008853744
LinkDB
Position
Un
AA seq 1675 aa
MKKILECPICLELIQEPVSTKCDHIFCKFCMLKLLNQKRGPSQCPLCKNEITKRSLQEST
RFSQLVEELLKITHAFELDTGLQFANSYSFLKKENKSSEHSHEESSVIECVGYRNRTKRL
RQNEPGNPTLQEDSFSDQLSNLGIVRPLKKNQQIRPQNKSVYIELGSDSSEDTVTKPNYY
NVRDQELLEITPQRSKAEAAEKADCEFSEDVANIEHHQSSNRDLNTIGSHSVEKHSEKYQ
GTSTSNLHEEPCGTDIHASLLQHENGSLLLTEDRMDVEMAELCSKSKQSGLAGSQQSRWA
GSKKTCHDRQSHSTEKKADLNADPLDEREKWNKQKAPSSESLSDTQDTPCVTLNSSIRKV
NEWFSKSGKMFTSYGTSDRHEASAEGAGTFEVSNEVEACSGSSEKIDLLASDPHNASVCR
SETVCSKPVERNIKDKIFGKTYQRKGSLPNLNHVTEILRAFASEPQITQEHPFTNKLKRR
RRTASCLHPEDFIKKADLTVVQKTSENINQGADQMEQNGQVLNITNGGHENKINDDNVQK
EKNPNPVESLEKESAFRTKAEPISNSISSLELELNVHNSKAPKKNRLRRKSSNRHILALE
LVSGNPSPPTHTILQIDSCSSSEETKGNNSNQMPVRHGKKHQLLEDAEPAAGSKESDEPD
ERVSRRGAGDVFSALKLTNTPGLLTNCSSSNKPQEFVSPHPQRKAIEKLETSKELKDPML
SEERGWSERSPESTSTSLVPDTDHGSQNSVSLLEPNTLRNANQGMAQYIACEKPKEPIYD
SKDTGNCTEGFKHPLGLELNHIQETSIDTEESELDTQYLQNICQVSKRQSFALVSNPRNP
EKESTTACAHSVFLRKLSPKPSLVREQKEKNQGWEESKISHIQAFNTTGDFAVVCQDDTP
GNDAKCTGVSRLCPSFQFRGRECELISADKPGISQNLHLKQSLSSIRSSVKTDHRKTLLE
ERFVEHSLPTEKAMDNEISIQSPVHTISQDSRENPCKEGSSDSVNEVGPSDEDFQEQLDR
NRGPRLSTVLRRSLMQPEAYKQSFPISDCKHPEIKKQEAQASSANISPCLFSEQLEQTMR
SGSVSQVCSETPDDLFDVDEIEENTSFGEGDIMERSAVFTKSILRREVSRSPVLLTHTSL
ARSHQKRSRKLESSSSEDEDLPCFQHLLGKVTSTSQITKHSPAVTQRLSEKTENQEPLKN
SINDCNSEMSLAEGSQEHHLSEDGKYSASMFSSQHSELEDVASNTNSQDLLFNSSKQMSH
PSENQEVVLSDKELISDDEEMESSLEKDNQEENEISDLDEAASAYEGEANLSEDSSQSDI
LTSQQRATMKVNLIKIQQEMAQLEAVLERQENLPSCCSTSLLADPCVPKDLLNPEQNVSK
TEVIPYLESGVTLFSRSHPESELSKEKAPEPAHVSISALKISQCQAAEYSKSPAAAHSTD
TEVAKTVSKTKSKWTSSKGRDKKISMVVSGLTHKEIMIVQKFAEKYHVTLSDVITEETTH
VIIKTDAEFVCERTLKYFMGIARGKWIVSYLWVIQSIKKRKLLNEQEFEVRGDVVNGRNH
QGPRRSRESQEKIFRGLEICCCEPFSSMPRDQLERILQMCGASVVKELSSLTFGTGTQPV
VVLQPSAWTERNDYLDIEKMCEAPVVMWDWVLDSISLYQRQNLETYLISACHPTS
NT seq 5028 nt   +upstreamnt  +downstreamnt
atgaagaaaatcttagagtgtccaatctgtctggaattgatccaagaaccagtatccaca
aagtgtgaccacatattttgcaagttttgtatgctgaaacttctcaaccagaagagaggg
ccttcacagtgtcctttgtgtaagaatgagataaccaaaagaagcctccaagaaagtaca
agatttagtcaacttgttgaagaactattgaaaatcactcatgcttttgagcttgacaca
ggattgcaatttgcaaatagttacagttttttgaaaaaggaaaataagtcttctgaacat
tcacatgaggagtcttctgtcattgagtgtgtgggctaccgaaaccgtaccaaaagactt
cggcagaatgagcctggaaatcccaccttgcaggaagacagtttcagtgaccaactctct
aatcttggaattgtgagacctctgaagaaaaatcaacagataaggcctcaaaataaatct
gtctacattgaattaggatctgattcttctgaagacaccgttactaagccaaattattac
aatgtgagagatcaagaattgctagaaatcactcctcaaagatccaaggctgaagctgca
gaaaaggctgattgtgagttttctgaggacgtagcaaatattgaacatcatcagtccagt
aatagagatttgaacaccattgggagtcattcagttgagaagcattcagaaaagtatcag
ggtacttctacttcaaacttgcatgaggagccatgtggcacagatattcatgccagctta
ttacagcatgagaatggcagtttattactcactgaagacagaatggatgtagaaatggct
gaactctgtagtaaaagcaaacagtctggcttagcagggagccaacagagcagatgggct
ggaagtaagaaaacatgtcatgatagacagagtcacagcacagagaaaaaggcagatctg
aatgctgatccccttgatgaaagagaaaaatggaataaacagaaggctccctcctctgag
agtcttagtgacacccaagatactccttgtgtaacactaaatagcagcattcggaaagtt
aatgaatggttttccaaaagtggtaaaatgttcacgtcttatggtacatctgacaggcat
gaggcaagtgctgaaggagctggtacatttgaggtttcaaatgaagtagaagcatgttct
ggttcttcagagaaaatagacttactggcttctgatcctcataatgcttcagtatgcaga
agtgaaacagtctgctccaaaccagtagagaggaatatcaaagataaaatatttgggaaa
acctatcagagaaagggaagccttcctaacttgaaccatgtgactgaaattttaagagca
tttgcttcagaaccacagatcacacaagagcatcccttcacaaataaattaaagcgtaga
aggagaactgcatcatgccttcatcctgaggattttatcaagaaagcagatttaacagtt
gttcaaaagacttctgaaaatataaatcagggagctgaccaaatggagcagaatggtcaa
gtgctaaatattaccaatggtggtcatgagaacaaaataaatgatgataatgttcagaaa
gagaaaaatcctaacccagtagaatcattggaaaaagagtctgctttcagaactaaagcc
gaacctataagcaacagtataagcagtttggaactagaattaaatgttcacaattcaaaa
gcacctaagaagaataggctcaggaggaagtcttctaacaggcatattcttgctcttgag
ctagtcagtgggaatccaagtccacctactcatactatacttcaaattgatagttgtagt
agcagtgaagaaacaaagggaaataattccaaccaaatgccagtgaggcatgggaaaaag
catcagctcctagaagatgcagaacctgcagctggctccaaggagagtgatgagccagat
gagcgagtaagcaggagaggtgctggtgatgtcttctcagcactgaaactaacaaatact
cctggcttattaaccaactgttcgagttctaataaacctcaagaatttgtcagtcctcac
cctcagagaaaagcaatagagaaacttgaaacaagcaaagagctcaaagatcctatgcta
agtgaagaaaggggttggtctgaaagatctccagagagtacgagtacttcattggtccct
gatacagatcatggctctcagaacagtgtctctttactggaacctaacactctcaggaat
gcaaatcagggtatggctcagtatatagcttgtgaaaaacccaaggaacctatatatgat
tctaaagatactggaaactgtacagagggcttcaagcatccattgggacttgaacttaac
cacattcaagaaacaagcatagacacggaagagagtgaactggatactcagtacttacaa
aatatatgccaggtctcaaagcgtcaatcatttgctctagtttcaaatcccagaaatcca
gaaaaggagtctacaacagcctgtgcccactctgtgttcttaaggaagctgagtccaaaa
ccgtctcttgtacgtgagcaaaaagaaaaaaatcaggggtgggaagagtctaaaatcagt
catatacaggcatttaataccacaggagactttgctgtggtttgtcaggacgatactcca
ggtaatgatgcaaagtgtacaggagtctctaggctttgtccatcatttcagttcagaggc
agggaatgtgaactcatctctgcagataaacctggaatttcacaaaatttgcatcttaaa
caatcactttcttccatcaggtcatctgtaaaaactgaccatagaaaaactttgttggag
gaaaggtttgtggaacattcattaccaactgaaaaggcaatggacaatgagatcagcatt
caaagtccagtgcatacaattagtcaagatagcagagaaaatccttgtaaagaaggtagc
tcagacagtgttaatgaagtaggtcccagtgatgaagactttcaagaacagctagataga
aacagaggacccaggttaagcactgtgctcagaagaagtcttatgcaacctgaagcctat
aagcaaagttttcctataagtgattgtaaacatcctgaaataaaaaagcaagaagcccag
gctagtagtgcaaacatctctccatgtctattttcagaacaactagagcaaacaatgaga
agtggcagtgtttctcaggtttgttctgagacacctgatgacctgtttgacgttgatgag
atagaggaaaatactagctttggggaaggtgacataatggaaaggtctgctgtttttacc
aagagtatcctgagaagagaggtcagcaggagccctgtccttttaacccatacatcactg
gctcgaagtcaccaaaaaaggtctaggaaattagaatcctcatctagtgaggatgaagat
cttccctgcttccaacacttacttggcaaagtaaccagtacatctcaaattaccaaacat
agccctgcagtgacacagcgtttgtcagagaaaacagagaaccaagaaccgttgaagaat
agcataaatgactgtaatagtgagatgagcttggcagagggatcccaggaacatcacctt
agcgaggacggaaaatactccgctagcatgttctcttcacagcacagtgaattggaagat
gtggcttcaaatacaaactcccaagatctcttgtttaattcttctaaacaaatgagtcac
ccatctgagaaccaggaagttgttctaagtgacaaggaattgatttcagatgatgaagaa
atggaaagtagcctggaaaaagataatcaagaggagaacgagatttcagatttagatgaa
gcagcatctgcatatgagggtgaagcaaacctttctgaagactcctcccagagtgatatt
ttgacaagtcagcagagagctaccatgaaagttaacctgataaagatccagcaggaaatg
gcccagctcgaagctgtgctagagcggcaggagaacctgccttcctgctgctccacttcc
ctcttagctgacccttgtgtccccaaggacctgctaaatccagaacaaaatgtatccaaa
acagaagtaattccatacctagaatctggagttacccttttctccaggagtcaccctgaa
tctgagctttctaaagagaaagccccagagccagctcatgtttcgatctctgccttgaaa
atatcccagtgtcaagctgcagaatattccaagagcccagctgctgctcatagcactgat
accgaggtggcaaaaaccgtgagcaagacaaagtcaaaatggacttcttcaaaaggaaga
gacaagaaaatatccatggtggtttcaggcttgacccacaaagaaataatgattgtgcaa
aagtttgccgaaaaataccacgtcaccttatctgatgtaataactgaggagactactcat
gtcattataaaaacagatgctgagtttgtgtgtgaacggacactgaaatattttatggga
attgccagaggaaaatggatagttagctatctctgggtgatccagtctattaaaaaaagg
aaacttttgaatgagcaagaatttgaagtcagaggagatgtcgtgaatggaagaaatcac
caaggtcccagacgatcaagagaatcccaggagaagatcttcaggggcctagaaatctgt
tgctgtgagcccttcagcagcatgcccagagatcaactggagaggatcctgcagatgtgt
ggggcgtctgtggtgaaggaactttcatcactcacctttggcacaggtactcagccagtt
gtggttctgcagccaagtgcctggacagaaaggaatgactaccttgatattgagaagatg
tgtgaggcacctgtggtgatgtgggactgggtgttggacagcatatccctctaccaacgc
cagaatctagaaacctacctgatcagtgcatgtcacccaacatcatga

DBGET integrated database retrieval system