KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103752029
Entry
103752029         CDS       T03372                                 

Gene name
Src
Definition
(RefSeq) SRC proto-oncogene, non-receptor tyrosine kinase
  KO
K05704  tyrosine-protein kinase Src [EC:2.7.10.2]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi01521  EGFR tyrosine kinase inhibitor resistance
ngi01522  Endocrine resistance
ngi04012  ErbB signaling pathway
ngi04015  Rap1 signaling pathway
ngi04062  Chemokine signaling pathway
ngi04137  Mitophagy - animal
ngi04144  Endocytosis
ngi04360  Axon guidance
ngi04370  VEGF signaling pathway
ngi04510  Focal adhesion
ngi04520  Adherens junction
ngi04530  Tight junction
ngi04540  Gap junction
ngi04611  Platelet activation
ngi04613  Neutrophil extracellular trap formation
ngi04625  C-type lectin receptor signaling pathway
ngi04727  GABAergic synapse
ngi04750  Inflammatory mediator regulation of TRP channels
ngi04810  Regulation of actin cytoskeleton
ngi04912  GnRH signaling pathway
ngi04915  Estrogen signaling pathway
ngi04917  Prolactin signaling pathway
ngi04919  Thyroid hormone signaling pathway
ngi04921  Oxytocin signaling pathway
ngi04926  Relaxin signaling pathway
ngi05100  Bacterial invasion of epithelial cells
ngi05135  Yersinia infection
ngi05152  Tuberculosis
ngi05161  Hepatitis B
ngi05163  Human cytomegalovirus infection
ngi05167  Kaposi sarcoma-associated herpesvirus infection
ngi05168  Herpes simplex virus 1 infection
ngi05203  Viral carcinogenesis
ngi05205  Proteoglycans in cancer
ngi05219  Bladder cancer
ngi05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103752029 (Src)
   04015 Rap1 signaling pathway
    103752029 (Src)
   04370 VEGF signaling pathway
    103752029 (Src)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103752029 (Src)
   04137 Mitophagy - animal
    103752029 (Src)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103752029 (Src)
   04520 Adherens junction
    103752029 (Src)
   04530 Tight junction
    103752029 (Src)
   04540 Gap junction
    103752029 (Src)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103752029 (Src)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103752029 (Src)
   04613  Neutrophil extracellular trap formation
    103752029 (Src)
   04625 C-type lectin receptor signaling pathway
    103752029 (Src)
   04062 Chemokine signaling pathway
    103752029 (Src)
  09152 Endocrine system
   04912 GnRH signaling pathway
    103752029 (Src)
   04915 Estrogen signaling pathway
    103752029 (Src)
   04917 Prolactin signaling pathway
    103752029 (Src)
   04921 Oxytocin signaling pathway
    103752029 (Src)
   04926 Relaxin signaling pathway
    103752029 (Src)
   04919 Thyroid hormone signaling pathway
    103752029 (Src)
  09156 Nervous system
   04727 GABAergic synapse
    103752029 (Src)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103752029 (Src)
  09158 Development and regeneration
   04360 Axon guidance
    103752029 (Src)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    103752029 (Src)
   05203 Viral carcinogenesis
    103752029 (Src)
  09162 Cancer: specific types
   05219 Bladder cancer
    103752029 (Src)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103752029 (Src)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    103752029 (Src)
   05152 Tuberculosis
    103752029 (Src)
   05100 Bacterial invasion of epithelial cells
    103752029 (Src)
  09172 Infectious disease: viral
   05161 Hepatitis B
    103752029 (Src)
   05168 Herpes simplex virus 1 infection
    103752029 (Src)
   05163 Human cytomegalovirus infection
    103752029 (Src)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103752029 (Src)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103752029 (Src)
   01522 Endocrine resistance
    103752029 (Src)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ngi01001]
    103752029 (Src)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ngi04131]
    103752029 (Src)
Enzymes [BR:ngi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     103752029 (Src)
Protein kinases [BR:ngi01001]
 Non-receptor tyrosine kinases
  SRC family
   103752029 (Src)
Membrane trafficking [BR:ngi04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    103752029 (Src)
 Endocytosis
  Clathrin-mediated endocytosis
   Kinases
    103752029 (Src)
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    103752029 (Src)
  Macropinocytosis
   Kinases
    103752029 (Src)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 SH3_1 SH3_9 SH3_2
Other DBs
NCBI-GeneID: 103752029
NCBI-ProteinID: XP_008853894
LinkDB
Position
Un
AA seq 542 aa
MGSNKSKPKDASQRRRSLEPTENVHGAGCAFPASQTPSKPASSDGHRGPGAAFVPPATAE
PKLFGGFNSSDTVTSPQRAGPLAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTRKV
DVREGDWWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNTENPRGT
FLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYS
KHADGLCHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTR
VAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLK
GETGKYLRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLI
EDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREV
LDQVERGYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGE
NL
NT seq 1629 nt   +upstreamnt  +downstreamnt
atgggcagcaacaagagcaagcccaaggatgccagccagcggcgccgtagcctggagccc
acggagaatgtgcacggggccggatgtgccttcccagcctcgcagacccctagcaagcca
gcctcctccgatggccaccgaggccccggcgccgcttttgtgccccccgcgactgcagag
cccaagctcttcgggggcttcaactcctcggacactgtcacctccccgcagagggcaggg
cccctggctggtggagtgaccaccttcgtagccctctatgactatgagtcacggacagaa
acagatctatccttcaagaaaggggaacggctacagattgtcaacaacacgaggaaggtg
gacgtcagagagggagactggtggttggcgcactcactcagcacaggacagaccggctat
atccccagcaactacgtggccccttctgactccattcaggctgaggagtggtacttcggc
aagatcactagacgggagtcagagcgattactgctcaacacagagaacccgagagggacc
ttccttgtgagggaaagtgagaccacaaaaggtgcctactgcctctctgtgtctgacttt
gacaacgccaagggcctcaatgtgaaacactacaagatccgcaagctggacagcggaggc
ttctacatcacctctcgcacccagttcaacagcctgcagcagcttgtggcttactattcc
aaacatgccgatggcctgtgccaccgtctcaccaccgtgtgccccacatccaagcctcag
acccagggcctggccaaggatgcctgggaaattccccgggagtccctgcggttggaggtc
aagctgggccagggctgcttcggagaagtgtggatggggacctggaacgggaccacgagg
gttgccatcaaaaccctgaagccaggcaccatgtctccagaggccttcctgcaggaggcc
caggtcatgaagaaactgaggcatgagaagctggttcagctgtatgctgtagtgtcagag
gagcccatctacattgtcacagagtacatgagcaagggaagtctgctggactttctcaag
ggggaaacgggcaagtacctacggctgcctcagctagtggacatggctgctcagatcgcc
tcaggcatggcatatgtggagcggatgaactatgtgcaccgggatctccgtgctgccaac
atcctggttggggagaacctggtgtgtaaagtggccgactttgggctggctcggctcatc
gaggacaacgaatacacagcccggcaaggtgccaaattccccatcaagtggacggcccct
gaagctgctctgtacggcaggttcaccatcaagtcggatgtgtggtcttttgggatcctg
ctgacggaactcaccaccaagggacgggtgccttaccctgggatggtgaaccgagaggtg
ctggaccaagtggagcggggctaccggatgccttgcccacccgagtgccctgagtcgctg
catgacctcatgtgccagtgctggcggaaggaacctgaggaacggcccaccttcgagtac
ctgcaggcctttctagaggactacttcacgtccactgagccgcagtaccagcctggggag
aatctatag

DBGET integrated database retrieval system