KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103752115
Entry
103752115         CDS       T03372                                 

Gene name
Tp53, p53
Definition
(RefSeq) tumor protein p53
  KO
K04451  tumor protein p53
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi01522  Endocrine resistance
ngi01524  Platinum drug resistance
ngi04010  MAPK signaling pathway
ngi04071  Sphingolipid signaling pathway
ngi04110  Cell cycle
ngi04115  p53 signaling pathway
ngi04137  Mitophagy - animal
ngi04151  PI3K-Akt signaling pathway
ngi04210  Apoptosis
ngi04211  Longevity regulating pathway
ngi04216  Ferroptosis
ngi04218  Cellular senescence
ngi04310  Wnt signaling pathway
ngi04722  Neurotrophin signaling pathway
ngi04919  Thyroid hormone signaling pathway
ngi05012  Parkinson disease
ngi05014  Amyotrophic lateral sclerosis
ngi05016  Huntington disease
ngi05160  Hepatitis C
ngi05161  Hepatitis B
ngi05162  Measles
ngi05163  Human cytomegalovirus infection
ngi05165  Human papillomavirus infection
ngi05166  Human T-cell leukemia virus 1 infection
ngi05167  Kaposi sarcoma-associated herpesvirus infection
ngi05168  Herpes simplex virus 1 infection
ngi05169  Epstein-Barr virus infection
ngi05200  Pathways in cancer
ngi05202  Transcriptional misregulation in cancer
ngi05203  Viral carcinogenesis
ngi05205  Proteoglycans in cancer
ngi05206  MicroRNAs in cancer
ngi05210  Colorectal cancer
ngi05212  Pancreatic cancer
ngi05213  Endometrial cancer
ngi05214  Glioma
ngi05215  Prostate cancer
ngi05216  Thyroid cancer
ngi05217  Basal cell carcinoma
ngi05218  Melanoma
ngi05219  Bladder cancer
ngi05220  Chronic myeloid leukemia
ngi05222  Small cell lung cancer
ngi05223  Non-small cell lung cancer
ngi05224  Breast cancer
ngi05225  Hepatocellular carcinoma
ngi05226  Gastric cancer
ngi05230  Central carbon metabolism in cancer
ngi05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103752115 (Tp53)
   04310 Wnt signaling pathway
    103752115 (Tp53)
   04071 Sphingolipid signaling pathway
    103752115 (Tp53)
   04151 PI3K-Akt signaling pathway
    103752115 (Tp53)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    103752115 (Tp53)
  09143 Cell growth and death
   04110 Cell cycle
    103752115 (Tp53)
   04210 Apoptosis
    103752115 (Tp53)
   04216 Ferroptosis
    103752115 (Tp53)
   04115 p53 signaling pathway
    103752115 (Tp53)
   04218 Cellular senescence
    103752115 (Tp53)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    103752115 (Tp53)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    103752115 (Tp53)
  09149 Aging
   04211 Longevity regulating pathway
    103752115 (Tp53)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103752115 (Tp53)
   05202 Transcriptional misregulation in cancer
    103752115 (Tp53)
   05206 MicroRNAs in cancer
    103752115 (Tp53)
   05205 Proteoglycans in cancer
    103752115 (Tp53)
   05203 Viral carcinogenesis
    103752115 (Tp53)
   05230 Central carbon metabolism in cancer
    103752115 (Tp53)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103752115 (Tp53)
   05212 Pancreatic cancer
    103752115 (Tp53)
   05225 Hepatocellular carcinoma
    103752115 (Tp53)
   05226 Gastric cancer
    103752115 (Tp53)
   05214 Glioma
    103752115 (Tp53)
   05216 Thyroid cancer
    103752115 (Tp53)
   05220 Chronic myeloid leukemia
    103752115 (Tp53)
   05217 Basal cell carcinoma
    103752115 (Tp53)
   05218 Melanoma
    103752115 (Tp53)
   05219 Bladder cancer
    103752115 (Tp53)
   05215 Prostate cancer
    103752115 (Tp53)
   05213 Endometrial cancer
    103752115 (Tp53)
   05224 Breast cancer
    103752115 (Tp53)
   05222 Small cell lung cancer
    103752115 (Tp53)
   05223 Non-small cell lung cancer
    103752115 (Tp53)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    103752115 (Tp53)
   05014 Amyotrophic lateral sclerosis
    103752115 (Tp53)
   05016 Huntington disease
    103752115 (Tp53)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103752115 (Tp53)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103752115 (Tp53)
   05161 Hepatitis B
    103752115 (Tp53)
   05160 Hepatitis C
    103752115 (Tp53)
   05162 Measles
    103752115 (Tp53)
   05168 Herpes simplex virus 1 infection
    103752115 (Tp53)
   05163 Human cytomegalovirus infection
    103752115 (Tp53)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103752115 (Tp53)
   05169 Epstein-Barr virus infection
    103752115 (Tp53)
   05165 Human papillomavirus infection
    103752115 (Tp53)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    103752115 (Tp53)
   01522 Endocrine resistance
    103752115 (Tp53)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ngi03000]
    103752115 (Tp53)
   03036 Chromosome and associated proteins [BR:ngi03036]
    103752115 (Tp53)
   03400 DNA repair and recombination proteins [BR:ngi03400]
    103752115 (Tp53)
Transcription factors [BR:ngi03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   p53
    103752115 (Tp53)
Chromosome and associated proteins [BR:ngi03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     103752115 (Tp53)
DNA repair and recombination proteins [BR:ngi03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    103752115 (Tp53)
SSDB
Motif
Pfam: P53 P53_tetramer P53_TAD TAD2
Other DBs
NCBI-GeneID: 103752115
NCBI-ProteinID: NP_001306217
UniProt: A0A0K1TP12
LinkDB
Position
Un
AA seq 391 aa
MEEQQSDLSIEPPLSQETFSDLWKLLPQNNVLSTPLSPNSMEDLLLSPEDVANWLDDPDE
ALQVPAAAITGDPVTETSAPVAPPPATPWPLSSSVPSQKTYQGSYGFRLGFLHSGTAKSV
TCTYSPPLNKLFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKKSQHMTEVVKRCPHHERC
SDSDGLAPPQHLIRVEGNLRAEYLDDKHTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSC
MGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENFRKKGELCPELPPG
STKRALPTGTSSSPQPKKKPLDGEYFTLKIRGRERFEMFRELNEALELKDTQAEKDSGES
RAHSSYLKSKKGQSTSRHKKLMIKREGPDSD
NT seq 1176 nt   +upstreamnt  +downstreamnt
atggaggaacaacaatcagatctcagcatcgaacctcccctgagtcaggagacattttca
gacttatggaaactgcttcctcagaacaatgttctgtccaccccactgtcacccaattcc
atggaagatctactgctgtccccagaagatgttgcaaactggttagatgatccagatgag
gccctccaagtgccagcagctgctataacaggggaccctgtgacagaaacctctgcacca
gtggctcctccaccagccaccccctggcctctatcatcttcagtcccttcccaaaaaacc
taccagggcagctatggtttccgtctgggctttctgcactcagggacagccaaatctgtc
acatgcacgtactccccgcccctgaacaagctgttctgccagctggcaaagacatgtcct
gtgcagctgtgggtcgactctacacctccacctggcacccgtgtccgtgccatggccatc
tacaagaagtcacaacacatgacagaagttgtaaagcgctgcccccaccatgagcgctgc
tctgacagcgatggcctggctcctcctcaacatctcatccgtgtggaaggaaatttacgt
gcagagtatttggatgacaagcacacttttcgacacagtgtggtggtaccatatgagcca
cctgaggttggctctgactgtactaccatccactacaactatatgtgtaatagctcctgc
atgggaggcatgaaccggaggcctatcctcactattatcacactggaagactccagtgga
aacctgctaggacggaacagctttgaggttcgagtttgtgcctgtcctggaagagaccgt
cgtacagaggaagaaaatttccgcaaaaagggggagctgtgccctgaactgccccctggg
agcactaagcgagcactgcccactggcacaagctcttctccccaaccaaagaagaaacca
ctagacggagaatatttcacccttaagatccgtgggcgtgaacgcttcgagatgttccgg
gagctgaatgaagccttggaactcaaggatactcaggctgaaaaggactcaggggagagc
agggctcactccagctacctgaagtccaagaagggccagtctacctcccgtcataaaaaa
ctaatgatcaagagagaagggcctgactcagactga

DBGET integrated database retrieval system