KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103752298
Entry
103752298         CDS       T03372                                 

Gene name
Tslp
Definition
(RefSeq) thymic stromal lymphopoietin
  KO
K05436  thymic stromal lymphopoietin
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103752298 (Tslp)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103752298 (Tslp)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103752298 (Tslp)
Cytokines and growth factors [BR:ngi04052]
 Cytokines
  CSF and other factors
   103752298 (Tslp)
SSDB
Motif
Pfam: TSLP
Other DBs
NCBI-GeneID: 103752298
NCBI-ProteinID: XP_017650581
LinkDB
Position
Un
AA seq 238 aa
MGKDREMQATEHKCLQMNIFLLFVLSVFFRKLFVLQLVGLVLTYNFSNCDFKKIVIIYDE
IISEDLKVPGKFTQIQPCYNAEEKANAKRSRDQGTESETPPPGVPSICCQHWLLTAAWEA
GRSEQAPSSCFPLLAPFHSIFNSWRFPHFSLNSAACEQTDCLMKIEHQTFNPASGCPSLP
RKPFAIKTKSTLTLHCPGYSGTQRNTTNQKTGKDIERNCRNQMLQIIAWWRHFCQIPK
NT seq 717 nt   +upstreamnt  +downstreamnt
atggggaaggacagggaaatgcaagccacagagcacaagtgtttacaaatgaacattttc
ttactgtttgttctgtcagtttttttcaggaagctcttcgtccttcaattggtagggctg
gtgctaacttataacttctctaactgtgactttaagaagattgtgatcatctatgatgaa
ataatttctgaagacctgaaggtcccgggcaagttcacccaaatacagccctgttacaat
gcggaggaaaaagcaaatgccaagcgaagccgggaccagggaacggagtctgagacacca
cctcccggagtccccagcatctgctgtcagcactggctcttgacagctgcctgggaggct
gggcggagcgagcaggcaccttcatcttgctttcctctccttgccccctttcattcaatt
tttaattcctggcgtttcccccatttctccttgaactctgccgcttgtgagcagacagat
tgcctcatgaaaatagagcaccagacttttaatcctgccagtggctgcccttcactaccc
cggaaaccattcgccataaaaacgaagtctaccctcactctccactgcccaggctactct
ggaactcagagaaacactactaaccagaaaacagggaaagacattgaacgcaactgtcgg
aatcaaatgttacaaatcatagcatggtggcgtcatttctgtcaaattccaaaataa

DBGET integrated database retrieval system