KEGG   Neisseria gonorrhoeae NCCP11945: NGK_0318Help
Entry
NGK_0318          CDS       T00728                                 

Definition
(GenBank) protein export protein SecD
  KO
K03072  preprotein translocase subunit SecD
Organism
ngk  Neisseria gonorrhoeae NCCP11945
Pathway
ngk03060  Protein export
ngk03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ngk00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    NGK_0318
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    NGK_0318
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ngk02044]
    NGK_0318
Secretion system [BR:ngk02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   NGK_0318
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SecD-TM1 SecD_SecF MMPL Sec_GG ACR_tran
Motif
Other DBs
NCBI-ProteinID: ACF29012
UniProt: B4RJK8
LinkDB All DBs
Position
259830..261686
Genome map
AA seq 618 aa AA seqDB search
MMNRYPLWKYLLIVFTIAVAAVYSLPNLFGETPAVQVSTNRQAIIINEQTQSKVDAALKN
AGIQTDGMFVVDNSLKVRFKDTETQLKARDVIENTLGEGYITALNLLADSPEWMAKIKAN
PMFLGLDLRGGVHFTMQVDMKAAMQKTFERYSGDIRRELRREKIRSGTVRQAENSLTVPL
QDAGDVQKALPQLLKLFPEATLNSEGSNIVLALSEEAVNKVRSDAVKQNITTLHNRVNEL
GVAEPIIQQSGLDRIVVQLPGVQDTAKAKDIIGRTATLEVRMVEDDPAKLREALEGNVPS
GYELLSSGGEHPETLLISKQVELTGDNINDAQPSFDQMGAPAVSLSLDSAGGSIFGELTA
ANVGKRMAMVLIDQGKSEVVTAPVIRTAITGGRVEISGSMTTAEANDTSLLLRAGSLAAP
MQIVEERTIGPSLGKENIEKGFHSTLWGFAIVAAFMVVYYRLMGFFSTIALSANILFLIG
ILSAMQATLTLPGMAALALTLGMAIDSNVLINERIREELRAGVPPQQAINLGFQHAWATI
VDSNLTSLIAGIALLVFGSGPVRGFAVVHCLGILTSMYSSVVVFRALVNLWYGRRRKLQN
ISIGAVWKPEAETAAGKE
NT seq 1857 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaccgttatcctttatggaaatatctgctgattgtgttcacgattgcggttgcc
gcagtgtattcgctgcccaacctattcggcgaaacgcccgccgtgcaggtatcgaccaac
cgacaagccatcatcatcaacgaacagactcaatccaaagtggatgctgcgctgaaaaac
gcgggcattcagaccgacgggatgtttgttgtggataattcactgaaagtgcgtttcaaa
gacacagaaacgcagcttaaagcgcgcgacgttatcgaaaacactttgggcgaagggtat
attaccgcgctcaacctgttggcggacagccccgaatggatggcgaaaatcaaagccaat
ccgatgtttttgggtttggacctgcgcggcggcgtgcatttcaccatgcaggtcgatatg
aaagccgcgatgcagaaaacgtttgagcgttattcgggcgacatccgccgcgaactgcgc
cgtgaaaaaatccgcagcggcacggtgcgtcaggctgaaaacagcctgaccgtccctttg
caggatgccggcgatgtgcaaaaggcactgcctcagttactcaagctgtttcctgaggca
acgttaaattcagaaggcagcaatattgtattggcgctttcggaagaggcggtgaataaa
gtacgatcagatgcggtgaagcaaaacatcactacactgcataaccgtgtaaacgaattg
ggtgtggcagagccgattatccaacagtcaggtttggaccgcattgtcgtacagcttccc
ggcgtgcaagatactgccaaggcaaaagacatcatcggccgtaccgcgactttggaagtc
cgcatggtggaggacgatcctgccaagttgcgcgaggcattggaaggcaacgtgccgagc
ggttatgagctgctttcaagcggcggggagcatcccgaaactctgctgatcagcaaacag
gtcgagctgaccggcgacaacatcaacgatgcgcaaccgagtttcgaccaaatgggcgca
cctgccgtcagtctgagcttggacagcgcgggcggcagcattttcggcgaactgactgcc
gcaaatgtcggcaaacgcatggcgatggttttgatcgaccaaggaaaatccgaggttgta
accgcaccggttatccgtactgccattaccggcggacgcgtggaaatttccggaagcatg
acgacagccgaagccaacgatacgtctttgctgttgcgtgccggttctcttgccgcaccg
atgcagattgtcgaagaacgtaccatcggtccgtctttgggtaaggagaacatcgaaaaa
ggcttccattcgactttatggggttttgccatcgttgctgcattcatggtggtttattac
cgcctgatgggtttcttttctactattgcattgagtgccaacatactgtttctaatcggt
attttgtctgccatgcaggcaacgttgacgttaccgggtatggccgcgctggcgttgact
ttgggtatggcaatcgactccaacgtcttgattaacgaacgtatccgagaggaattgcgt
gccggcgtgccgccgcagcaggcaatcaatctcggtttccaacacgcatgggcgaccatt
gttgattcgaacctgacttcgctgattgccggtatcgcgcttttggtattcggttccgga
ccggtaagaggttttgccgtcgtacactgcttgggtattctgacttcgatgtattcgtcc
gtcgtcgtattccgtgcgttggtcaatctgtggtacggccgccgccgcaaattgcagaac
atttccatcggtgcggtatggaaacctgaagccgaaactgcggcaggtaaggagtaa

DBGET integrated database retrieval system