KEGG   Neisseria gonorrhoeae NCCP11945: NGK_1343Help
Entry
NGK_1343          CDS       T00728                                 

Definition
(GenBank) excinuclease ABC subunit C
  KO
K03703  excinuclease ABC subunit C
Organism
ngk  Neisseria gonorrhoeae NCCP11945
Pathway
ngk03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:ngk00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    NGK_1343
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ngk03400]
    NGK_1343
DNA repair and recombination proteins [BR:ngk03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     NGK_1343
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UvrC_HhH_N GIY-YIG UVR HHH HHH_2 HHH_5 HHH_3 5_3_exonuc
Motif
Other DBs
NCBI-ProteinID: ACF30017
UniProt: B4RMI3
LinkDB All DBs
Position
1106695..1108581
Genome map
AA seq 628 aa AA seqDB search
MPSEAVFQMIDMNTENRSPEQFDIPLFLKNLPKLPGVYRFFDEGGNVLYVGKAVNLKRRV
SGYFQKNDHSPRIALMVKQVRHIETTITRSEAEALILENNFIKALSPKYNILFRDDKSYP
YLMLSGHQYPQMAYYRGTLKNPNQYFGPYPNSNAVRDSIQVLQKVFMLRTCEDSVFEHRD
RPCLLYQIKRCTAPCVGHISEEDYCDSVRQAATFLNGKTDELTRTLQHKMQTAAANLQFE
EAARYRDQIQALGIIQSDQFIDSKNPNNPNDIDLLALAVSDGLVCVHWVSIRGGRHVGDK
SFFPDTKNDPEPNGQDYAEAFVAQHYLGKSKPDIIISNFPVPDALKEALEGEHGKQMQFV
TKTIGERKVWLKMAEQNAQMAITQRHLQQSNQQHRIDELAKILGMNSDGINRLECFDISH
TQGEATIASCVVYDEQNIQPSQYRRYNITTAKPGDDYAAMREVLTRRYGKIQEAEANGES
VKWPDVVLIDGGKGQIGVAVSVWEELGLHIPLVGIAKGPERKAGMEELILPFTGELFRLP
PNSPALHLLQTVRDESHRFAITGHRKKRDKARVTSSLGDIPGVGSKRRQALLTRFGGLRG
VIAASREDLEKVEGISKALAETIYNHLH
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atgccgtctgaagccgtttttcaaatgattgatatgaatacagaaaaccgttctccggaa
caattcgacatcccgctcttcctcaaaaacctgcccaagctgccgggcgtgtaccgtttt
tttgacgaaggcggcaacgtcttatacgtcggcaaagcggtcaacctcaagcggcgcgtg
tccggctatttccaaaaaaacgaccattcgccgcgcatcgcgttgatggtgaaacaggtt
cgccacatcgaaaccaccatcacgcgttccgaagccgaagccctgattctcgaaaacaac
ttcatcaaagccttgtcgccgaaatacaatatcctttttcgcgacgacaaaagctatcct
tatttgatgctcagcggccatcaatatccgcaaatggcgtattaccgcggcacgctgaaa
aatcccaaccaatacttcggcccgtatccgaacagcaacgccgtgcgcgacagcattcaa
gtgttgcaaaaagtcttcatgctgcgtacctgcgaagacagcgtgttcgaacaccgcgac
cgcccttgcctactgtaccaaatcaaacgctgcaccgcgccctgcgtcggacacatcagc
gaagaagactactgcgacagcgtgcgtcaagccgccactttcctcaacggcaaaaccgac
gaactgacccgcaccctgcaacacaaaatgcagaccgccgccgcgaatctgcaatttgaa
gaagccgcccgttatcgcgaccaaatccaagcactcggcattatacagagcgaccagttc
atcgacagcaaaaacccgaacaaccccaacgatatcgacctgctcgcgctcgccgtttca
gacggccttgtctgcgtacactgggtcagcatccgcggcggacggcacgtcggcgacaaa
agcttctttcccgacaccaaaaacgaccccgaaccaaacggtcaagattacgccgaagcc
ttcgtcgcccaacactatctgggcaaaagcaaacccgacatcatcatcagcaactttccc
gttcccgatgcgttgaaagaggctttggaaggagaacacggcaagcagatgcagttcgtt
accaaaaccataggcgaacgcaaagtttggttgaaaatggcggaacaaaacgcacaaatg
gcgattacccaacgccacctgcaacaaagcaaccaacaacaccgcatcgacgaacttgcc
aaaatcctcggcatgaattcagacggaatcaaccgccttgaatgtttcgatatcagccac
acgcaaggcgaagccaccatcgcctcctgcgtcgtgtacgacgaacaaaacatccaaccc
tcgcaataccgccgctacaacatcaccaccgccaaacccggcgacgactacgccgccatg
cgcgaagtgttgacgcgccgttatggcaaaatacaggaagccgaagccaacggcgaaagc
gtcaaatggccggatgtcgtgttgattgacggcggtaaagggcaaatcggcgtagccgta
tccgtatgggaagaactcgggctgcacatccctttagtcggtattgccaaaggccccgaa
cgcaaagccggcatggaagaactcatactgccttttaccggcgaactcttccgcctgcct
cctaatagcccggccttgcatttattgcaaaccgtacgcgatgaatcacaccgctttgcc
atcacaggccaccgtaaaaaacgcgacaaagcacgcgttacctcgtctctcggcgacatt
cccggtgtaggcagcaaacgccgccaagccctgcttacccgcttcggcggactgcgcggc
gtgattgccgccagccgcgaggacttggaaaaagtggaaggcatcagcaaggcattggcg
gaaaccatttataatcatctgcattag

DBGET integrated database retrieval system