KEGG   Neorhizobium galegae bv. officinalis bv. officinalis HAMBI 1141: RG1141_CH07400Help
Entry
RG1141_CH07400    CDS       T03208                                 

Definition
(GenBank) Glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
ngl  Neorhizobium galegae bv. officinalis bv. officinalis HAMBI 1141
Pathway
ngl00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:ngl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    RG1141_CH07400
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ngl02000]
    RG1141_CH07400
Enzymes [BR:ngl01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     RG1141_CH07400
Transporters [BR:ngl02000]
 Other Transporters
  Pores ion channels [TC:1]
   RG1141_CH07400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_C GST_C_2 GST_N_2 GST_C_3
Motif
Other DBs
NCBI-ProteinID: CDN53100
UniProt: A0A068T6Y0
LinkDB All DBs
Position
complement(721878..722537)
Genome map
AA seq 219 aa AA seqDB search
MRPVLYSHPFSSYCQKVLTALYENGTDFDTRMLGPEDPSAYQDLCSMWPVKRFPILIDGE
KRVFESSIVIEYLDQHYPGPVKLIPDDADAALDVRTMDRFFDNYISTPQQKVVFNAIRPE
ESRDPYGVQEARDMLDAAYGWLDQRMADREWAAGEAFSLADCAAAPALFYADWTHRIGEQ
FAHVRAYRKRLLARPSFARAVDEARPYRSFFPLGAPDRD
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgcgtccggttctgtattcacatccattctcgtcctactgccagaaggtgctgaccgcg
ctctatgagaacggcaccgacttcgacacccgcatgctcgggccggaggatccttcagct
tatcaggatctctgcagcatgtggccggtgaagcgttttccgatcctgatcgacggggag
aaacgggtcttcgaatcgtcgatcgtcatcgaatatctcgaccagcattatcccggcccg
gtaaaactaatcccggacgacgcggacgcggcgctcgacgtgcggacgatggaccgcttc
ttcgacaactacatttccacgccgcagcagaaggtcgtcttcaacgccatccgcccggaa
gagagccgcgatccctatggcgtgcaggaagcccgcgacatgctggacgccgcctatggc
tggctggaccagcgcatggcggaccgggaatgggcggctggagaggcgttcagcctcgcc
gactgcgccgcggcgcccgccctcttctatgcggactggacgcaccggatcggcgagcag
ttcgcccatgtgcgggcctatcgcaagcggctgctcgcccgaccgtcttttgcgcgcgcg
gtggacgaggcccggccttaccgctcgttcttcccgctcggcgcaccggatcgggactag

DBGET integrated database retrieval system