KEGG   Neorhizobium galegae bv. officinalis bv. officinalis HAMBI 1141: RG1141_CH10130Help
Entry
RG1141_CH10130    CDS       T03208                                 

Definition
(GenBank) Alr protein
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
ngl  Neorhizobium galegae bv. officinalis bv. officinalis HAMBI 1141
Pathway
ngl00473  D-Alanine metabolism
ngl01100  Metabolic pathways
ngl01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ngl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    RG1141_CH10130
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    RG1141_CH10130
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ngl01011]
    RG1141_CH10130
Enzymes [BR:ngl01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     RG1141_CH10130
Peptidoglycan biosynthesis and degradation proteins [BR:ngl01011]
 Precursor biosynthesis
  Racemase
   RG1141_CH10130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: CDN53372
UniProt: A0A068T4G4
LinkDB All DBs
Position
complement(963294..964457)
Genome map
AA seq 387 aa AA seqDB search
MTDFDSELSYPDDFDIAPVRLTVDLGALGDNWREMARRSGTARTAAVVKADAYGLGLEDC
GITLYEAGARDFFVAVVQEGVTLRTYAPDARIYVLSGIWPGQERMFFEHDLVPVLASEEQ
LAFWMSVTAEYGDHPCALQVDTGFNRLGLPLEDAIAFSDDVSRPASFSPVLVLSHLHSGD
TPSSPLNQKQLSAFQKVAEAFEGIETSLSASAGIFLGPDYHFDLTRPGIALYGGEAVVGV
PNPMKPVAKAEARIIQIRDGKKGETVSYGGTYQLSRDSRLAIVSAGYADGYKRALSGSGV
PLRQTIGQGGFGFIAGREVPVIGRITMDLTIFDVTDIPASDIQAGDYVELFGPNVALDDV
ARAAGTIGYELLTSLGLRYERRYIEAE
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatttcgacagcgagctttcctatcccgacgatttcgacatcgcgcccgtgcgg
ctgacggtcgatctgggtgcgcttggcgacaattggcgggagatggcgcggcgttcggga
acggcgcggacggcggccgtcgtcaaggccgatgcctacgggctcgggctggaggattgc
ggcatcacgctttacgaggccggcgcccgggatttcttcgtggcagtggtgcaggaaggc
gtgacgctgcgcacctatgcgcccgacgcccggatctacgtactctccggcatctggccc
ggccaggagcggatgttcttcgaacacgatctggtgcccgttctggcctccgaggaacag
ctggccttctggatgtcggtgacggcggaatatggcgaccacccctgcgcgctgcaggtg
gacaccggcttcaaccggctcggcctgccgctcgaggacgccatcgccttctccgacgac
gtgtcgcgtccggcaagcttctcgccggtcctggtgctctcgcatctccacagcggcgat
accccctcctcgccgctcaaccagaaacagctttcggccttccagaaggtcgcggaggct
ttcgaaggcatcgagacgagtctttcggcatctgccggcatcttcctcggccccgactat
catttcgatctcacccgccccggcatcgcgctttatggcggcgaagcggtggtcggagtg
ccgaacccgatgaagccggtcgccaaggcggaagcccgcatcatccagatccgcgacggc
aaaaagggcgagacggtgagctacggcggcacttatcagctctcccgcgacagccggctg
gcgatcgtctctgcgggttacgcggacggctacaaacgcgcactctccggctccggcgtg
ccgctgcgccagaccatcggtcagggcggcttcggcttcatcgccggccgcgaggttccg
gtcatcggccgcatcaccatggacctgacgatcttcgacgtcaccgatatcccggcatcg
gacatccaggccggcgactatgtcgaactgttcggccccaacgtcgccctcgacgacgtc
gcccgcgccgccggcacgatcggctacgaactgctgaccagcctcggcctgcgctatgag
cggcggtacatcgaggccgaataa

DBGET integrated database retrieval system