KEGG   Neorhizobium galegae bv. officinalis bv. officinalis HAMBI 1141: RG1141_CH12580Help
Entry
RG1141_CH12580    CDS       T03208                                 

Definition
(GenBank) Translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
ngl  Neorhizobium galegae bv. officinalis bv. officinalis HAMBI 1141
Brite
KEGG Orthology (KO) [BR:ngl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:ngl03012]
    RG1141_CH12580
   03029 Mitochondrial biogenesis [BR:ngl03029]
    RG1141_CH12580
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ngl04147]
    RG1141_CH12580
Translation factors [BR:ngl03012]
 Eukaryotic Type
  Elongation factors
   RG1141_CH12580
 Prokaryotic Type
   RG1141_CH12580
Mitochondrial biogenesis [BR:ngl03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    RG1141_CH12580
Exosome [BR:ngl04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   RG1141_CH12580
  Exosomal proteins of breast cancer cells
   RG1141_CH12580
  Exosomal proteins of colorectal cancer cells
   RG1141_CH12580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: CDN53610
UniProt: A0A068T8D6
LinkDB All DBs
Position
1208893..1210068
Genome map
AA seq 391 aa AA seqDB search
MAKSKFERNKPHVNIGTIGHVDHGKTSLTAAITKYFGEYKAYDQIDAAPEEKARGITIST
AHVEYETPARHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHILLARQ
VGVPAIVVFLNKVDQVDDAELLELVELEVRELLSSYDFPGDDIPIIKGSALAALEDSDKK
IGEDSIRELMAAVDAYIPTPERPINLPFLLPIEDVFSISGRGTVVTGRVERGIVKVGEEV
EIVGIRATTKTTVTGVEMFRKLLDQGQAGDNIGALIRGVQRDGVERGQILCKPGSVKPHK
KFMAEAYILTKEEGGRHTPFFTNYRPQFYFRTTDVTGIVSLPEGTEMVMPGDNVTVAVEL
IVPIAMEEKLRFAIREGGRTVGAGIVASIIE
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagagcaagtttgagcgcaacaagccgcacgtcaacattggcacgatcggtcac
gttgaccatggcaagacgtcgctgacggccgcgatcacgaagtacttcggcgagtacaag
gcctatgaccagatcgacgcggctcctgaagaaaaggcacgcggcatcaccatttcgacg
gcgcacgtcgaatatgagacgccggcccgccactatgcgcacgtcgactgccccggccac
gccgactatgtgaagaacatgatcaccggtgcggcgcagatggacggcgcgatcttggtt
tgctcggctgccgacggcccgatgccgcagacccgcgagcacatcctgctcgcccgtcag
gttggcgttccggcaatcgtggtgttccttaacaaggtcgaccaggtcgacgacgccgag
cttctcgagctcgtcgagctggaagtgcgcgaacttctgtcgtcctacgacttcccgggc
gacgacattccgatcatcaagggttcggcactggccgctcttgaagattcggacaagaag
atcggcgaagattcgatccgcgagctgatggccgctgtcgacgcctacatcccgacgccg
gagcgtccgatcaacctgccgttcctgctgccgatcgaagacgtgttctcgatctcgggc
cgcggtacggtcgtcaccggccgcgtcgagcgtggtatcgtcaaggttggcgaagaagtc
gagatcgtcggcatccgcgccaccaccaagacgacggtgaccggcgttgaaatgttccgc
aagctgctcgaccagggccaggccggcgacaacatcggcgcgctgatccgtggcgtccag
cgtgacggcgtcgagcgtggccagatcctgtgcaagccgggttcggtcaagccgcacaag
aagttcatggctgaagcctatatcctgacgaaagaagaaggcggtcgtcatacgccgttc
ttcaccaactaccgtccgcagttctacttccgcacgacggacgtgacgggcatcgtttcg
ctgccggaaggcacggaaatggtcatgccgggcgacaacgtgaccgttgccgtcgagctg
atcgttccgatcgcgatggaagaaaagctgcgcttcgcaatccgcgaaggcggccgtacc
gtcggcgccggcatcgtcgcctcgatcatcgagtaa

DBGET integrated database retrieval system