KEGG   Neorhizobium galegae bv. officinalis bv. officinalis HAMBI 1141: RG1141_CH20940Help
Entry
RG1141_CH20940    CDS       T03208                                 

Definition
(GenBank) D-Ala-D-Ala ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ngl  Neorhizobium galegae bv. officinalis bv. officinalis HAMBI 1141
Pathway
ngl00473  D-Alanine metabolism
ngl00550  Peptidoglycan biosynthesis
ngl01100  Metabolic pathways
ngl01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ngl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    RG1141_CH20940
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    RG1141_CH20940
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    RG1141_CH20940
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ngl01011]
    RG1141_CH20940
Enzymes [BR:ngl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     RG1141_CH20940
Peptidoglycan biosynthesis and degradation proteins [BR:ngl01011]
 Precursor biosynthesis
  Amino acid ligase
   RG1141_CH20940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 CPSase_L_D2 GARS_A ATP-grasp_3 ATPgrasp_ST ATP-grasp
Motif
Other DBs
NCBI-ProteinID: CDN54433
UniProt: A0A068T7M2
LinkDB All DBs
Position
complement(2039666..2040592)
Genome map
AA seq 308 aa AA seqDB search
MSDKHVAVLMGGFSSERPVSLSSGAACADALEGEGYRVTRVDVGRDVAAVLSELRPDVAF
NALHGPFGEDGTIQGILEYLEIPYTHSGVLASALAMDKHQAKHVAKASGIPVAEAKAMSR
FDIGNAHPMKPPYVVKPVREGSSFGVVIVQENQSHPPQIIGSSEWRYGDRVLVERYVYGR
ELTCGVMGDVALGVTEVVPLSHAFYDYDAKYAEGGSKHVIPAQISPNIYQKIQTLALKAH
QAMGCRGVSRSDFRYDDRFSENGEVIWLEINTQPGMTPTSLVPEMAGHAGHSFGELVRWM
VEDATCLR
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacaagcacgtggctgttttgatgggaggattttcctccgagcggcctgtcagc
ctgtcctcgggcgctgcctgtgcggatgctctcgaaggcgaaggctaccgcgtcacccgc
gtcgatgtcggccgggatgtggcggccgtcctctcggagcttcggccggacgtcgccttc
aacgccttgcatgggcctttcggcgaggacgggacgatccagggcattctcgaatatctc
gaaattccctatactcattccggcgtgctcgcgtctgcgctcgccatggacaagcatcag
gctaagcatgttgccaaggcgtccggcattccggtcgccgaagccaaggcgatgagccga
ttcgatatcggcaatgctcacccgatgaagccgccttacgtggtgaagccggtccgcgag
gggtcgtccttcggtgtcgtgatcgtccaggaaaatcagtcgcatccgccgcagattatc
ggctcgtccgagtggcgctacggtgatcgggttctggtcgagcggtatgtctatggccgc
gagctcacctgcggcgtgatgggcgatgtggcgcttggggttaccgaagtggtgccgctt
agccacgccttttacgattacgacgcgaaatatgcggagggtggttcgaaacacgtcatt
ccggcgcagatttcaccgaatatttaccaaaagattcaaacactggcgctcaaggcgcat
caggcgatgggctgccgtggcgttagtcgctccgactttcgctacgacgaccgcttctcc
gagaacggcgaggtcatctggctggaaatcaatacgcagccgggtatgaccccgacctca
ctggtgcccgaaatggccggccatgccggccactcatttggtgaactcgtccgttggatg
gtggaggacgctacgtgtttgcgttga

DBGET integrated database retrieval system