KEGG   Neorhizobium galegae bv. officinalis bv. officinalis HAMBI 1141: RG1141_CH21750Help
Entry
RG1141_CH21750    CDS       T03208                                 

Definition
(GenBank) NAD-dependent aldehyde dehydrogenase
Organism
ngl  Neorhizobium galegae bv. officinalis bv. officinalis HAMBI 1141
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh TPP_enzyme_N TPP_enzyme_C TPP_enzyme_M XFP_N
Motif
Other DBs
NCBI-ProteinID: CDN54514
UniProt: A0A068T8R6
LinkDB All DBs
Position
2137009..2140092
Genome map
AA seq 1027 aa AA seqDB search
MNKMSLDFLSGSTKLRGQTVSGAVFEFLRQKGIDRIFGNPGSTELPMFVNVPEDFSYVLG
LQESIVVAMADAYAQVSRKPAFVNLHSAAGLGHALGNIYTAYRNRAPLIITTGQQSRELL
PHDPFLFAESPTEFPKPYVKWACEPARAEDVPAAIARAYHMAMQAPRGPVMVSVPLSDWQ
AQAAPIAIRDVETVISAPASAIDDLARRLNEAREPVLVVGPGVDIDNAWDATVRLAEILQ
AKVWVSPLSSRCSFPERHPLFAGFLPAFQPKLANCLGDADLVLVLGAPAFTYHFAGSGPD
IPQGAELWLITDDPAQAASAIVGNAMVSNLRAATESLVYRLRCRAPRTGGPARTIPRLKQ
PKGITQEFFYQTLAGVRSPESIVFEEAPGARDALHDFLPIERPGGFFATASGGLGYALPG
SVGAALTKPEQPVIAVIGDGSSLYSIQSIWSAVEYDADLMIVILNNGGYKVLKAIAERSG
SGRIDGVDIRHMDFVQIAEAQGCKAVRCEKGEELSSCLRDLLKMKGPRLLEIILSEEETE
MNVAVRNEQVLKTPEKFFIGGEWVAPLGTNKLDVISPVTEEVLMSYPEASNADIDRAVAA
ARDAFDNGPWPRMTFKERAGYMRKVADLLTARLDEIANAWTTQVGAPIFLTKKLVGQNPG
LYNYYAGLIENDEFVDQRKRADGGEVRVVREPVGVCAAITPWNAPMVLLNYKVSAALAAG
CTIVAKPSPETPLDAYLLAECIEQAGIPKGVFNLVPAGREGGDYLVRHKGIDKVSFTGST
IAGKTIAAACADRLTRVSLELGGKSAAVLLDDADFAKALPALMVYSMPITGQVCFSLTRI
LVPESRKQEFIDLYVGAVKNIKVGDPADPTTQMGPLTMARQLARVEGYIAAGRAGGATVA
CGGGRPAGLDRGYFIEPTVFTDVTMDMKIAQEEIFGPVVSIISYKDDEEAVKIANDSTYG
LSGAVFSSDPERGYAFARRMRTGSVTVNGMIVDIHHPFGGFKQSGIGREGGPEGLENYFE
VKTIHMA
NT seq 3084 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagatgtcgctggatttcctatccggcagcaccaagctgcgtggacagacggta
agcggggcggttttcgaatttctgaggcagaagggcatcgaccggatcttcggcaatccg
ggctcgaccgaactgccgatgttcgtcaacgtgccggaagacttttcctatgtgctcggc
ctgcaggaatcgatcgtcgtcgcgatggcggacgcctatgcgcaagtgagccgcaagccg
gcattcgtaaacctgcattcggccgccggcctcggccatgcgctcggcaatatctatacg
gcctaccgcaaccgcgcgcctctcatcatcaccaccggccagcagagccgcgagctgctg
ccgcacgacccgttcctgttcgccgaaagcccgaccgagtttccgaaaccctatgtgaaa
tgggcctgcgaacccgcccgcgccgaagacgtgccggccgcgatcgcccgcgcctaccac
atggcgatgcaggcaccgcgcggcccggtcatggtgtcggtgccgctcagcgactggcag
gcgcaggcagccccgatcgccattcgcgatgtggaaacggtgatcagcgcgcccgcctcc
gcaattgacgatctcgcccgccggctgaacgaagcccgcgagccggtgctggtcgtcggg
ccgggcgtcgatatcgacaatgcctgggatgccaccgtgcggcttgcggaaatcctgcag
gcgaaagtctgggtgagcccgctttcgtcccgctgcagctttcccgaacgccatccgctg
tttgccggtttcctgccggccttccagccgaagctcgccaattgcctcggtgacgccgac
ctcgtgctggtgctcggcgcgccggccttcacctatcatttcgcgggctccggcccggac
atcccgcaaggtgccgaactctggctgatcaccgacgatccggcccaggcggcaagcgcc
atcgtcggcaacgccatggtctcgaacctgcgcgccgcgaccgaaagccttgtctaccgc
ctgcgctgccgtgcgccacgtaccggcggccctgcccgcactattccgcgcctgaaacag
ccaaagggcatcacccaggaatttttctaccagacactggcaggcgtccgttcgcctgag
agcatcgtcttcgaggaagccccaggcgctcgcgacgcgctgcacgatttcttgcccatc
gagcggcccggcggctttttcgcgacggccagcggcggccttggttatgccctgcccggc
tcggtcggcgctgccctcaccaagccggaacagccggtcatcgccgtcatcggcgacgga
tcgagcctctattccatccagtcgatctggtctgccgtcgaatacgatgccgatctgatg
atcgtcatcctcaacaatggcggctacaaggtcctgaaggcgattgccgagcggagcggc
tccggccgcatcgacggcgtcgatatccgccacatggattttgtgcagatcgccgaagcg
cagggctgcaaggccgttcgctgcgaaaaaggcgaggaattgtcgtcatgcctgcgggat
cttctcaagatgaaggggccgcggcttttggaaatcattctatcagaggaggagactgaa
atgaatgtcgctgtcagaaacgaacaggtcctgaaaacccccgaaaagttcttcatcggc
ggtgaatgggtcgcgccactcggcaccaacaagctcgacgtcatctcgccggtgaccgaa
gaagtgctgatgagctatccggaagccagcaacgccgatatcgacagggccgttgccgcc
gcccgcgacgccttcgacaacggcccgtggccgcgcatgaccttcaaggaacgcgccggt
tacatgcgcaaggtcgccgacctcctgaccgcccgcctcgacgagatcgccaatgcctgg
acgacccaggtcggcgcgccgattttcctgaccaagaagctggtcggccagaacccgggc
ctctacaactattatgccggcctgatcgagaacgacgagttcgtcgatcagcgcaagcgc
gccgatggcggcgaagtccgcgtggtgcgcgagccagtcggcgtctgcgcggcgatcacc
ccgtggaacgcgccgatggtgctcttgaactacaaggtctcggcagcgcttgccgccggc
tgcacgattgtcgccaagccctcgccggaaaccccgctggacgcctatctgcttgccgaa
tgcatcgagcaggctggcattccgaagggcgtcttcaacctggtgccggccggccgtgaa
ggcggcgattacctcgtgcgccacaagggcatcgacaaggtgtcgttcaccggctcgacc
attgccggcaagacgatcgccgctgcctgcgccgatcgcctgacccgcgtcagcctcgaa
ctcggcggcaagtccgcagccgtgcttctcgacgatgccgacttcgccaaggcgctgccg
gcgctgatggtctattccatgccgatcaccggccaggtctgtttctcgctgacccgcatc
ctggtaccggaatcccgcaaacaggaattcatcgacctctatgtcggcgcggtcaagaac
atcaaggtcggcgacccggcggatccgaccacccagatggggccgctcaccatggcccgc
cagcttgcccgcgtcgaaggttatatcgctgccggccgcgcaggcggtgcgacggttgcc
tgcggcggcggtcgcccggccggtctcgaccgcggttatttcatcgagccgaccgtcttt
accgacgtgacgatggacatgaagatcgcccaggaggaaatcttcggcccggtcgtgtcg
atcatcagctacaaggatgatgaggaagcggtcaaaatcgccaacgacagcacctacggc
ctgtccggcgcggtcttcagctccgatccggagcgtggctatgcgtttgcccgccgcatg
cggaccggcagcgtcaccgtcaacggcatgatcgtcgacatccaccacccgttcggcggc
ttcaagcagtccggcatcggccgcgaaggcggcccggaaggtctcgaaaactattttgag
gtcaagacgatccatatggcctga

DBGET integrated database retrieval system