KEGG   Neorhizobium galegae bv. officinalis bv. officinalis HAMBI 1141: RG1141_CH25850Help
Entry
RG1141_CH25850    CDS       T03208                                 

Definition
(GenBank) Thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
ngl  Neorhizobium galegae bv. officinalis bv. officinalis HAMBI 1141
Pathway
ngl00240  Pyrimidine metabolism
ngl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ngl00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    RG1141_CH25850
Enzymes [BR:ngl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     RG1141_CH25850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 AAA_30
Motif
Other DBs
NCBI-ProteinID: CDN54922
UniProt: A0A068T8U9
LinkDB All DBs
Position
complement(2549762..2550343)
Genome map
AA seq 193 aa AA seqDB search
MAKLYFHYATMNAGKSTMLLQASYNYRERGMRTAIFTASLDDRAGRGRVASRIGLSSDAI
PFEPSDDLFMGIEAMHREEPIACVFVDEAQFLSPEQVWQLARISDRVGIPVMTYGLRTDF
QGKLFPGSLELLAIADELREVRTICHCGRKATMVVRLDEDGKLVREGAQVDVGGSEKYVS
LCRRHWEDQMHCD
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggccaagctttatttccactacgcgacgatgaacgccggcaagtcgaccatgctgctg
caggcttcctataactaccgagagcgcggcatgcgcacggcgatcttcacggcgtcgctg
gacgaccgcgccggccggggccgagtggcctcgcggatcgggctctcctccgacgccatt
cccttcgagccgtccgacgatctctttatgggcatcgaggcgatgcaccgggaggagccg
atcgcctgcgtgttcgtcgacgaggcgcagttcctctcgcccgagcaggtctggcagctc
gcccggatttccgaccgggtcggcatcccggtaatgacctatggcttgaggaccgatttc
cagggcaagctgtttcccggctcgctggagctgctggcgatcgccgacgagctgcgcgag
gtgcgcaccatctgccattgcgggcgcaaggcgaccatggtggtgaggctcgacgaggac
ggcaagctggtgcgcgaaggtgcccaggtcgatgttggcggcagcgaaaaatatgtttcg
ctctgccggcggcattgggaagatcagatgcattgcgattga

DBGET integrated database retrieval system