KEGG   Neorhizobium galegae bv. officinalis bv. officinalis HAMBI 1141: RG1141_CH27420Help
Entry
RG1141_CH27420    CDS       T03208                                 

Definition
(GenBank) Maltose alpha-D-glucosyltransferase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
ngl  Neorhizobium galegae bv. officinalis bv. officinalis HAMBI 1141
Pathway
ngl00500  Starch and sucrose metabolism
ngl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ngl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    RG1141_CH27420
Enzymes [BR:ngl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     RG1141_CH27420
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     RG1141_CH27420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase hDGE_amylase DUF3459 Malt_amylase_C
Motif
Other DBs
NCBI-ProteinID: CDN55079
UniProt: A0A068TAD9
LinkDB All DBs
Position
2690359..2692020
Genome map
AA seq 553 aa AA seqDB search
MINDLWYKNAVVYCLSVETFMDSNGDGIGDFQGLQRRLDYISGLGVNAIWLMPFQTSPGR
DDGYDVSDYYNVDPRYGTLGDFVEFTHGARQRGIRVLIDLVVNHTSTQHPWFQNARSDPE
SYYRDWYIWSDKKPANANEGMVFPGVQKTTWTYDEKARQYYFHRFYEFQPDLNTSNPHVQ
AEILKIMGFWIQLGVSGFRMDAVPFVIAEKGADVKKPREQFAMLRVFREFLQWRLGDSII
LAEANVVPKENLAYFGDDGDRMQMMFNFHVNQALFYALASGDARPLAKAIVNTSDRPETG
QWGMFLRNHDELDLGRLTEKQRQKVFSEFGPDKNMQLYDRGIRRRLAPMLENDRRRLELA
YSLLFSLPGTPVLRYGDEIGMGDDLSLPERNCARTPMQWSAEPHGGFTKNDKPVLPVISG
GLFGFEHINVAEQRRDPNSMLNWTERLIRMRKEAPEIGWGACTVLNTGDTGVLALRYDWR
DNSVLIVHNLNSKPVEVTFVVGIGEHGDLLIDIADGGNSEADANGRHRLLLDAYAYRWFR
VGGLDYLLRRKEV
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
gtgatcaacgacctctggtacaagaacgccgtcgtctattgcctctccgtcgagaccttc
atggattccaatggcgacgggatcggggatttccagggcttgcaacggcggctggactat
atctccggtctcggcgtcaatgccatctggctgatgccgttccagacctcgcccggccgg
gacgacggttacgacgtctccgactactacaatgtcgacccgcgctacggcacgctcggc
gatttcgtcgaattcacccatggcgcccggcagcgcggcattcgggtgctgatcgatctc
gtagtcaaccacacgtccacccagcatccctggttccagaacgcccgcagcgacccggaa
tcctactatcgcgactggtatatctggtccgacaagaagccggcgaatgccaatgagggc
atggtgtttccgggcgtgcagaagacgacctggacctatgacgaaaaggccaggcaatat
tactttcaccgcttctacgagttccagccggatctcaacacctccaacccgcatgtgcag
gcggaaatcctcaagatcatgggtttctggatccagctcggtgtttccggttttcgcatg
gatgccgtgccattcgtgatcgccgaaaagggtgccgacgtgaaaaagccgagggagcag
ttcgccatgctccgggtttttcgcgaattcctgcaatggcggctcggagattcgatcatc
cttgccgaagccaatgtcgtgccgaaggagaacctcgcgtatttcggcgatgacggcgat
cgcatgcagatgatgttcaactttcacgtcaaccaggccctgttttatgcgctcgcctcc
ggagacgcccggccgctggcaaaagcaatcgtcaataccagcgatcggcctgaaacggga
caatggggcatgttcctgcgcaatcacgatgaactcgatcttggtcgcctgaccgaaaaa
cagcgccagaaagtgttttcggaattcgggccggacaagaacatgcagctctacgaccgc
ggcatccgacggcggctggcgccgatgctggagaacgaccggaggcgcctggaactcgcc
tacagcctgctgttttcgctgcccggcacgccggtgctacgttatggcgacgagattggc
atgggtgacgacctgtcgctgccagagcgcaactgcgcccgcacgccgatgcaatggtcg
gccgagccgcatggaggcttcaccaagaacgacaagccggtcctgccggttatcagcggc
ggactattcggttttgagcacatcaacgtcgctgagcaacggcgcgacccgaactcgatg
ttgaactggacggagcgcctgatccggatgcgcaaggaagccccggagatcggctggggc
gcctgcaccgtcctcaacaccggggataccggcgtgctggcactccgttacgattggcgc
gacaattccgtgctgatagtccacaacctgaattcgaaaccggtcgaagtaaccttcgtg
gtcggtatcggagagcatggcgatcttctcatcgatatcgcagacggtggcaacagcgag
gcggatgccaacggccggcaccggctcctgctcgatgcctatgcctatcgctggttccgg
gtcggcggtctcgattacctgctgcggcgcaaggaagtatag

DBGET integrated database retrieval system