KEGG   Neorhizobium galegae bv. officinalis bv. officinalis HAMBI 1141: RG1141_CH28610
Entry
RG1141_CH28610    CDS       T03208                                 

Definition
(GenBank) DTDP-glucose 4,6-dehydratase
  KO
K01710  dTDP-glucose 4,6-dehydratase [EC:4.2.1.46]
Organism
ngl  Neorhizobium galegae bv. officinalis bv. officinalis HAMBI 1141
Pathway
ngl00521  Streptomycin biosynthesis
ngl00523  Polyketide sugar unit biosynthesis
ngl00525  Acarbose and validamycin biosynthesis
ngl01100  Metabolic pathways
ngl01110  Biosynthesis of secondary metabolites
Module
ngl_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:ngl00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    RG1141_CH28610
   01055 Biosynthesis of vancomycin group antibiotics
    RG1141_CH28610
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    RG1141_CH28610
   00525 Acarbose and validamycin biosynthesis
    RG1141_CH28610
Enzymes [BR:ngl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.46  dTDP-glucose 4,6-dehydratase
     RG1141_CH28610
SSDB
Motif
Pfam: GDP_Man_Dehyd Epimerase RmlD_sub_bind 3Beta_HSD Polysacc_synt_2 NAD_binding_4 adh_short KR Sacchrp_dh_NADP
Other DBs
NCBI-ProteinID: CDN55198
UniProt: A0A068T9S2
LinkDB
Position
2811731..2812792
AA seq 353 aa
MRVLVTGGAGFIGSAVVRHLVLVRNYDVLTVDKLTYAGNVASLATVENNPRHRFLQADIC
NRAAMQEAFDSFKPDRVMHLAAESHVDRSITGARDFVETNVVGSFTLLEAARHYWQDLFG
KAKTDFRFLHVSTDEVYGSLGEDGLFTEETPYDPSSPYSASKAASDHLAKAWGRTYGMPV
IVSNCSNNYGPYHFPEKLIPLIVLNALESKSLPVYGNGANIRDWLFVEDHARALDLIAER
GRIGETYNIGGRNERSNIEVVKRICSIMDTLRPQKAPHERLITYVRDRPGHDARYAIDAT
KLEVELGWEAEENFDTGIEKTVKWYLENEWWWAPLRQGYGGGRLGLLNGSGGK
NT seq 1062 nt   +upstreamnt  +downstreamnt
atgcgcgtccttgttaccggcggagccgggttcatcggatcggctgtcgtgcgtcatctg
gttctcgtcagaaactacgacgtcttgaccgtagacaagctgacttatgccggcaacgtg
gcgtcgctcgccaccgtcgagaacaatccgcggcatcgtttccttcaggcagacatttgc
aatcgagcggcgatgcaggaggcgttcgacagtttcaaacccgaccgagtcatgcatctg
gcggcggagagccatgtggaccgctctataactggcgcccgcgacttcgtcgaaaccaac
gtcgtcggctcatttaccttgctggaggcagcccggcactactggcaggatctcttcggc
aaagcgaaaacagactttcgctttctccacgtctcaaccgacgaggtttatggctctctc
ggcgaagacggattgttcaccgaagaaaccccctacgatccctcttctccctattcagcg
tccaaagcagcctctgatcacctggccaaagcgtggggccgcacctatggcatgccggtt
attgtctccaactgctcgaacaattacggcccttatcacttccctgaaaaactgatcccg
ctgattgtgctgaatgctctagagagcaaatcgctgccagtttacggcaacggcgccaat
atccgcgactggctatttgtcgaggaccacgcaagggcgctggacctcatcgccgaacgc
ggcaggattggcgaaacatacaatatcggcggccgcaatgagcggagcaacatagaggtg
gtcaagcgcatctgctcgatcatggataccctccggccgcagaaagccccacacgagcga
ctgatcacatatgtcagggaccggccagggcatgacgcacgttacgcaatcgacgccacg
aagctcgaggtggaactgggttgggaggcggaagaaaacttcgataccgggatcgaaaag
acggtcaagtggtacctggaaaacgaatggtggtgggcgccgcttcgtcagggatacggc
ggtggccggctcggcctccttaacggatccggaggcaaatga

DBGET integrated database retrieval system