KEGG   Neorhizobium galegae bv. officinalis bv. officinalis HAMBI 1141: RG1141_CH36080Help
Entry
RG1141_CH36080    CDS       T03208                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
ngl  Neorhizobium galegae bv. officinalis bv. officinalis HAMBI 1141
Pathway
ngl00020  Citrate cycle (TCA cycle)
ngl00310  Lysine degradation
ngl00380  Tryptophan metabolism
ngl01100  Metabolic pathways
ngl01110  Biosynthesis of secondary metabolites
ngl01120  Microbial metabolism in diverse environments
ngl01130  Biosynthesis of antibiotics
ngl01200  Carbon metabolism
Module
ngl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ngl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ngl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RG1141_CH36080
  09105 Amino acid metabolism
   00310 Lysine degradation
    RG1141_CH36080
   00380 Tryptophan metabolism
    RG1141_CH36080
Enzymes [BR:ngl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     RG1141_CH36080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: CDN55936
UniProt: A0A068TD23
LinkDB All DBs
Position
complement(3638994..3642059)
Genome map
AA seq 1021 aa AA seqDB search
MRRPEIFSGSDYVRRRARRPQITMARQEANEQFLITSFLDGQNAAYIEQLHARYEDEPTS
VSPEWQAFFKALADNPDDVKAAAKGASWQRKNWPITANGELVSALDGNWPIVEKAIETKV
KAKAEATAAATGKPVNETDVLQATRDSVRAIMMIRAYRMRGHLHAKLDPLGIASAVEDYN
ELSPSAYGFTEADYDRKIFIDNVLGLEYATLRQMIEILERTYCSTLGVEFMHISNPEEKS
WIQERIEGPGKGVEFTPEGKKAILSKLVEAEGYEQFLDVRFKGTKRFGLDGGESLIPALE
QIIKRGGQEGLEEVVLGMPHRGRLNVLTNVMHKPHRAVFHEFKGGSFKPDEVEGSGDVKY
HLGASSDREFDGNKVHMSLTANPSHLEIVNPVVMGKARAKQDMLAKAWDGDIIPLKERSK
VLPLLLHGDAAFAGQGVVAEILGLSGLRGHRVAGTMHVIVNNQIGFTTNPAFSRSSPYPS
DVAKMIEAPIFHVNGDDPEAVVYAAKVATEYRMKFHKPVVIDMFCYRRFGHNEGDEPAFT
QPKMYKVIRAHKTVAQIYADRLIAEGLVTDGEFEKMKADWRANLETEFEAGQSYKPNKAD
WLDGQWSGLRSADNADEQRRGKTAMPMKELREIGRKLATIPEGFNAHRTIKRFMENRSQM
VETGEGIDWAMAEALAFGSLAVEGTKIRLSGQDCERGTFSQRHSVLYDQDTEERYIPLAN
LSPTQARYEVINSMLSEEAVLGFEYGYSLARPNALTLWEAQFGDFANGAQVVFDQFISSG
ERKWLRMSGLVCLLPHGYEGQGPEHSSARLERWLQMCAEDNMQVANVTTPANYFHILRRQ
TKRDFRKPLILMTPKSLLRHKRATSTLAEMAGESAFHRLLWDDAEVIKDGPIKLQKDAKI
RRVVLCTGKVYYDLLEEREKRGIDDIYLLRIEQLYPFPAKALINELSRFRNAEMVWCQEE
PKNMGAWSFIDPYLEWVLAHIDAKYQRVRYTGRPAAASPATGQMSKHLAQLEAFLEDALG
G
NT seq 3066 nt NT seq  +upstreamnt  +downstreamnt
atgcggaggccagagatattttccggctccgattacgtcaggaggcgggcgcggcgcccg
cagataaccatggcacggcaagaagccaacgagcagttcctcatcacctctttcctcgac
ggacagaacgcggcctatatcgagcagcttcatgcgcggtatgaggacgaaccgacatcc
gtctcgccggaatggcaggccttcttcaaggcgctcgccgacaatccggacgatgtgaag
gcggccgccaagggagcctcgtggcagcgcaagaactggccgatcacggccaacggcgaa
ctggtgtcggcactcgacggcaactggccgatcgtcgaaaaggcgatcgaaacgaaggtc
aaggcgaaggcggaagcgactgctgccgcgaccggcaagccggtcaacgaaaccgatgtg
ctgcaggcgacgcgcgatagcgtccgcgccatcatgatgatccgcgcctaccgcatgcgc
ggccacctgcatgccaagctcgatccgctcggcattgccagcgcggtcgaggactataac
gaactgtcgccgtccgcttacggcttcaccgaagcagactacgaccgcaagatcttcatc
gacaacgtgctcggcctcgaatacgcgacgctgcgccagatgatcgagattctggagcgg
acctattgctcgacgctcggtgtcgagttcatgcacatctccaatccggaagaaaagtcc
tggatccaggaacgtatcgaaggcccgggcaagggcgtcgaattcacgccggaaggcaag
aaggcgattctttccaagctcgtcgaagcggaaggttacgaacagttcctcgacgtccgg
ttcaagggcaccaagcgcttcggcctcgacggtggtgaatcgctgatcccggcgctcgaa
cagatcatcaagcgcggcggccaggaaggccttgaagaagtcgttctcggcatgccgcac
cgcggccgcctgaacgtgctcaccaacgtcatgcacaagccgcatcgcgcggtgttccac
gagttcaagggcggttcgttcaagccggacgaagtcgaaggttcgggcgacgtcaagtac
catctcggcgcttcgtcggaccgcgagttcgacggcaacaaggttcacatgtcgctgacg
gctaacccgtcgcatctggaaatcgtcaacccggtggtcatgggcaaggctcgcgccaag
caggacatgctcgccaaggcctgggacggcgatatcattccgctgaaggaacgctccaag
gttctgcctcttctgctgcacggcgatgccgcgtttgcgggccagggcgtcgtggccgaa
atcctcggcctgtcgggcctgcgcggccatcgcgttgccggcacgatgcacgtcatcgtc
aataaccagatcggcttcaccaccaatccggccttctcgcgttcgtcgccttatccgtcc
gacgtcgcaaagatgatcgaggcgccgatcttccacgtcaatggcgacgatccggaagcg
gtcgtctatgccgccaaggtcgcgaccgaataccggatgaagttccacaagccggtcgtc
atcgacatgttctgctaccgccgcttcggtcataacgaaggcgacgagccggcgttcacg
cagccgaagatgtacaaggtcatccgcgcccacaagaccgtcgcgcagatctatgccgac
cgcctgatcgccgaaggtctcgtcaccgacggcgaattcgagaagatgaaggccgactgg
cgcgccaatctcgaaaccgagttcgaggccggccagagctacaagccgaacaaggccgac
tggctggacggccagtggtcgggcctgcgctcggccgacaatgccgacgaacagcgccgc
ggcaagactgcgatgccgatgaaggaactgagggaaatcggccgcaagctggcgaccatt
ccggaaggcttcaacgcgcaccgcaccatcaagcggttcatggagaaccgttcgcagatg
gtcgagaccggcgaaggcatcgactgggccatggcggaagccctggcattcggctcgctt
gccgtcgaaggcaccaagatccgcctctccggtcaggattgcgaacgcggcacgttctcg
cagcgtcactcggttctctacgatcaggacaccgaagagcgctacatcccgctcgccaac
ctgtcgccgacccaggctcgttacgaagtcatcaactcgatgctttcggaagaggcggta
ctcggcttcgaatacggttattcgcttgcccgtccgaatgcgctgaccctctgggaagcc
cagttcggcgacttcgccaacggtgcgcaggtcgtgttcgaccagttcatctcgtctggt
gaacgcaagtggctgcgcatgtccggtctcgtctgccttctgccgcacggttatgaaggc
cagggtccggaacactcttcggcccgcctggaacgctggctgcagatgtgtgccgaagac
aacatgcaggtcgccaacgtcacgacgccggccaactacttccacatcctgcgccggcag
acgaagcgcgacttccgtaagccgctgatcctgatgacgccgaagtcgctgctgcgccac
aagcgggccacctcgacgcttgccgaaatggccggcgaatcggccttccatcgcctcctc
tgggacgatgcggaggtcatcaaggatggtccgatcaagctgcagaaggatgccaagatc
cgtcgcgtcgtgctctgcaccggcaaggtctattacgaccttctcgaagagcgcgaaaag
cgcggcatcgacgacatctacctgctgcgcatcgaacagctctatccgttcccggccaag
gccctgatcaacgagctctcccgcttccgcaatgcggaaatggtctggtgccaggaagag
ccgaagaacatgggcgcatggtcgttcatcgacccgtatctggaatgggttctggcgcat
atcgatgccaagtatcagcgtgtccggtatacgggccggccggcagcggcctcgcctgca
acgggccagatgtcgaagcatctcgcacagctcgaagccttcctcgaagacgcgctcggc
ggctga

DBGET integrated database retrieval system