KEGG   Neorhizobium galegae bv. officinalis bv. officinalis HAMBI 1141: RG1141_PA02900Help
Entry
RG1141_PA02900    CDS       T03208                                 

Definition
(GenBank) Xylose isomerase
  KO
K01805  xylose isomerase [EC:5.3.1.5]
Organism
ngl  Neorhizobium galegae bv. officinalis bv. officinalis HAMBI 1141
Pathway
ngl00040  Pentose and glucuronate interconversions
ngl00051  Fructose and mannose metabolism
ngl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ngl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    RG1141_PA02900
   00051 Fructose and mannose metabolism
    RG1141_PA02900
Enzymes [BR:ngl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     RG1141_PA02900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: CDN57125
UniProt: A0A068THZ4
LinkDB All DBs
Position
pHAMBI1141a:289300..290280
Genome map
AA seq 326 aa AA seqDB search
MPEPRFATRLNSFASKPKAEWPDLSGKPTMMQMATRAAKVEGLTDLDLNYPDHVADDPSL
LAGMIGDLGLAINGFAMRYYTNPAFKIGAFTNPDPAVRREAIDLTKKGIDAARAAGSNLM
TLWLGQDGFDYAFQANYHMLWQHEVDGIREVCAHDPDCQISIEYKPNEPRSYSLMPDCAT
TLLAIKDVDMPNLGVTLDFAHVLYADEQPAFAAALIARYSRLLGVHLNDGYAKRDDGLMV
GAVHAQQTIELLCQIRKDGYDGAIYFDTFPDMTGLDPVHECEVNIQTVKRMLTVVDRLEQ
DNRLSGAIDRQDAVSAQAVVQELMLG
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
gtgccagaaccgagatttgccacccgactgaattcttttgcctcgaagccgaaggccgaa
tggcccgatctttcgggcaagccgacaatgatgcagatggcgacgcgcgcagccaaggtc
gaaggtctgacggatctcgatctcaactatcctgaccatgttgccgacgatccgtcgctt
ctggcaggtatgatcggcgatctcggcctggcgatcaacggcttcgccatgcgttattat
accaatccggccttcaagatcggtgccttcaccaaccccgatccggcggttcgccgcgag
gcgatcgacttgacgaagaaaggcatcgacgcggcgcgcgccgccggcagcaacctgatg
acgctctggctcggacaggatggtttcgattatgcctttcaggccaactatcatatgttg
tggcaacacgaagtagatggaattcgtgaagtttgcgcccatgatcccgactgccagatc
agcatcgaatacaaaccgaacgagccacgctcctacagcctgatgcccgattgcgcgacc
acgcttcttgcgatcaaggacgtcgatatgcctaatctgggcgtgacgctggatttcgcc
catgtgctctatgccgacgagcagccggcctttgccgctgctctcatcgcccgatacagc
cggctcctcggcgttcatctcaacgacggctatgccaagcgcgacgacggcctgatggtc
ggcgcggtgcatgcccagcagacgatcgagcttctgtgtcagatccgtaaggacggctat
gacggcgcgatttatttcgacacgtttcccgatatgaccggtctcgatccggtccacgaa
tgcgaggtaaacatccagaccgtcaagcggatgctgacggtggtggatcgcctcgagcag
gacaaccgcctttccggggcgattgaccgacaggatgccgtatctgcgcaggccgttgtc
caagaactgatgctcggctga

DBGET integrated database retrieval system